Search This Blog

I want to enable teachers to make miracles happen in the worst circumstances, & empower every child to shine & impact their community.

Understanding The New SPM (2021) English 1119 Paper Format

This outline & those of other SPM language papers were made .

1. Very Similar to PT3-2019

As you can see, there are many similarities between SPM2021 & PT3-2019.

2. 4 Papers Rather Than Previous 2

3. grades for each skill & an overall grade, 4. only 1 out of 4 papers will be assessed by lpm, 5. kssm = less emphasis on reading & writing, 6. possible changes to the marking criteria for spm writing.

Curriculum Target Levels taken from the DSKP KSSM Bahasa Inggeris Tingkatan 4 .
Common European Framework of Reference - Global Scale (2018) .

7. Expect Changes Over Time

Popular posts from this blog, what to do when your unifi service suddenly drops.

Image

How To Fix Logitech Options Not Loading

Image

The Millennial Trains Project: A Transcontinental Conference On Tracks

A review of mosquito coils in the market.

Image

english essay kssm

Other sites on the StudyMalaysia Network

PostgradMalaysia.com

Featured Institutions

  • Asia Pacific University (APU)
  • City University Malaysia (CITY U)
  • First City University College

MAHSA University

Management and science university (msu), saito university college, the one academy of communication design (toa).

  • Tunku Abdul Rahman University of Management and Technology (TAR UMT)
  • Universiti Tunku Abdul Rahman University (UTAR)
  • What to Study

Malaysian Students

  • Higher Education in Malaysia
  • Private Education Routes
  • Public Higher Education Routes
  • Technical & Vocational Training
  • English in Malaysia
  • International School Education in Malaysia

Related Education Bodies

  • Higher Education Governing Authorities
  • Other Government Agencies

News & Events

  • Latest News
  • Event Calendar
  • Career Guide
  • Explore Your Career
  • Know Yourself and Career Interest Assessment
  • List of Possible Careers for You
  • Choosing the Best Study Route
  • Explore 27 Fields of Study
  • Free Online Course Interest Test

Other Useful Articles

  • Top Stories
  • Useful Tips
  • SkillsMalaysia INVITE
  • International Students
  • Why Study in Malaysia
  • Applying & Entering Malaysia to Study
  • The National Education System
  • Learning English in Malaysia
  • Study Opportunities in Foreign Languages
  • Going Abroad From Malaysia
  • Scholarships
  • Need Help? Ask Studymalaysia

english essay kssm

  • Universities & Colleges
  • What to Study (Courses)
  • StudyGuardian
  • Course Interest Test

english essay kssm

  • Student Info & Guide

Tips on How to Tackle the SPM English Papers 1 & 2

by StudyMalaysia.com on February 23, 2022 | Top Stories , Learning English in Malaysia

SPM English Papers 1 & 2

In line with the Kurikulum Standard Sekolah Menengah (KSSM), the new SPM format for SPM English is more comprehensive and covers all aspects of English learning. Since the new format is adapted from the Common European Framework of Reference (CEFR) it is similar to the Cambridge English paper and the grading will also follow the CEFR Measuring system.

The aspirational target for SPM leavers would be level B2 where they are equipped with adequate English for further studies and later on career enhancement.

Basic Users

  • level A1 (Elementary/Beginner)
  • level A2 (Pre-Intermediate/Elementary)

Independent Users

  • level B1 (Intermediate/Pre-Intermediate)
  • level B2 (Upper Intermediate/Intermediate)

Proficient Users

  • levels C1 and C2 (Advanced)

CEFR Grading for SPM will be only up to B2.

Basically any English test is about understanding what you’re reading. Thus you should take time to comprehend what you’re reading and accomplish the task according to what is asked for.

SPM Paper 1

Paper I tests Reading and Use of English. It consists of 5 parts. The time allocated is 90 minutes. (40 marks)

Part 1: 8 Multiple Choice Questions consisting of short texts from books, magazines, advertisements etc. Candidates will choose the best answer from 3 choices given for each question. (8 marks)

ADVICE: Very quickly read through the question before reading the text given. This gives you an idea of what you will be looking for in the text. After this go through all the three options given before deciding on the answer. Make sure you read all the options as there may be slight differences in the answers given.

Part 2: Cloze Passage. You should try to get all the 10 answers correct. The passage tests you on grammar and vocabulary. There are 4 options given for each blank. (10 marks)

ADVICE: Do not attempt to fill in the gaps on your first reading of the text. First, read through the text quickly to see what it is about and determine the tense or tenses required for the text. Then go to the answers given and determine the right word for each blank.

Part 3: Here you will need to read a longer passage and answer 8 questions related to the text. This is of course a test on reading comprehension. (8 marks)

ADVICE: Take time to read the text carefully before going on to the questions. Some of the questions direct you to specific paragraphs to look for the answers. For other questions, look for key words to enable you to zoom in to the right paragraphs to look for the answers. Once again read through all the options given before deciding on your answer.

Part 4: In this section you are given a longer text from which six sentences have been removed. You have to choose the 6 correct sentences from among 8 choices given to fill in the gaps to form a correctly structured paragraph. (6 marks).

ADVICE: Here is where you have to apply your skills on ‘coherence and cohesion’ to find the correct sentence to fill the blank. Your sentence should blend in smoothly with the sentences before and after the blank.

Part 5: You are given a few paragraphs on a certain topic to read. You are given four statements which describe 4 of the paragraphs given. You have to identify the 4 paragraphs to fit the statements given. For the next 4 questions you are required to find words (one word each from the text) to complete the 4 sentences given. (8 marks)

ADVICE: Read the short texts carefully and determine the main idea in each text. This will help you decide to pick the statement which best describes the text.

SPM Paper 2

This essay and writing paper is worth 60 marks. However, the weightage in the overall SPM English paper is still at 25%. The time allocated for this paper is 90 minutes and the paper has 3 parts.

Part 1 - Students are required to write a short note or email in less than 80 words. (20 marks)

ADVICE: Read the email or short note carefully and underline the tasks given to you so that you will not miss out on any point. For example the task set out may want you to suggest

  • a place to visit
  • some activities to be done there (give a few - about three)
  • things to bring (suggest a few - about three)

As you have only 80 words to juggle with, you must go straight to the point with a little elaboration if necessary.

Part 2 - This is Directed Writing in 125 - 150 words. (20 marks)

ADVICE: In this question, notes will be given to you to guide you on what to write. Whatever it is, the golden rule is to give at least three to four suggestions so that there will be enough subject matter for you to write about. Here you may need to give your opinion or provide proof for your suggestions. Do not write longer than required.

Part 3 - In this section, you are given 3 choices for a descriptive writing

(report/review/article/story). You will need to choose I essay to write in 200 - 250 words. (20 marks)

ADVICE: This essay calls for all your writing skills. Quickly mind-map four to five main points you want to talk about in your essay. For each point briefly jot down elaborations/examples/reasons to expand the point. Then organise your paragraphs with each main point as your topic sentence for each paragraph. Think of a good introduction and conclusion. The introduction and the conclusion should not be too lengthy.

For the writing task, you will be assessed on

task achievement - Have you answered according to what is required by the question?

What are your key points? Do you support your key points with proof or definite opinion?

coherence and cohesion - Are all your paragraphs part of a whole? Does each of the

paragraph have a key point? Do all the sentences in each paragraph talk about the key point? Use cohesive devices like thus, therefore, moreover, furthermore, on the contrary ... etc to help you.

vocabulary - You will need to show you have a wide range of vocabulary at your disposal. A wide vocabulary enables you to write better essays. To acquire a wide vocabulary you need to read books, magazines and newspapers. When you come across any good words or expressions jot them down in your vocabulary book. Learn how to use these words or expressions in the right contexts. Try not to use descriptive words more than twice in the same essay. For example:

Last holiday my whole family went for a very interesting trip to the East Coast. We stayed at an interesting holiday resort. While we were there we joined a lot of interesting activities.

Writing a paragraph like the above will show your limited vocabulary usage.

grammar - Make sure to use the correct tenses throughout your writing. Punctuations

are equally important as a wrong punctuation may contribute to misunderstanding.

5. sentence structures - Your writing should show

  • variety in sentence structures ( There should be a combination of simple, compound and complex sentences in your essay. Make sentences of different lengths and with different beginnings.)
  • vivid and interesting sentences - Write interesting sentences by adding adjectives to nouns, adverbs to verbs, adjective phrases and clauses. Students should learn how to use synonyms, idioms, figurative language, similes, proverbs etc. Avoid making spelling mistakes.

use of direct speech or quotes - Wherever possible adding a quote or a direct speech can break the monotony in your essay.

Do your best!

After years of studying, your success will be measured by your performance in this coming examination. Best wishes from us at STUDYMALAYSIA!

  • www.moe.gov.my
  • https://www.superprof.com.my
  • StudyMalaysia editorial team

Copyright © StudyMalaysia Sdn Bhd (studymalaysia.com), February 2022

You May Also Be Interested In...

More than rm6million worth of scholarship and bursary for spm/igcse students.

More Than RM6million Worth of Scholarship and Bursary for SPM/IGCSE Students - StudyMalaysia.com

MQA (Malaysian Qualifications Agency) and Higher Education Study Pathways

MQA (Malaysian Qualifications Agency) and Higher Education Study Pathways - StudyMalaysia.com

How to Embark on a Successful Career in Marketing

How to Embark on a Successful Career in Marketing - StudyMalaysia.com

Ramadan Recipes - Bamia Kambing

Ramadan Recipes - Bamia Kambing - StudyMalaysia.com

Studying in Ireland: The smart choice for education, career and life

Studying in Ireland: The smart choice for education, career and life - StudyMalaysia.com

Featured Universities & Colleges

english essay kssm

Asia Pacific University of Technology & Innovation (APU)

Ranked in the Top 2.2% in the World, QS World University Ranking 2024

english essay kssm

City University

english essay kssm

Design Your Future

english essay kssm

AAT (the Association of Accounting Technicians)

english essay kssm

Tunku Abdul Rahman University of Management and Technology (TARUMT), Main Campus

english essay kssm

First City University College (FCUC)

More universities & colleges.

  • Akademi Laut Malaysia (ALAM)
  • Asian Tourism International College
  • Berjaya University College
  • Claz'room College
  • Dasein Academy of Art
  • DRB-HICOM University of Automotive Malaysia
  • Equator College
  • HELP University
  • Heriot-Watt University Malaysia
  • i-CATS University College
  • MDIS College Malaysia
  • Penang International Dental College (PIDC)
  • RCSI & UCD Malaysia Campus
  • Raffles University
  • Sarawak Skills Development Centre
  • School of Skills
  • System & Skills Training Concept (SSTC)
  • UCSI University
  • Universiti Tenaga Nasional (UNITEN)
  • Universiti Tunku Abdul Rahman (UTAR)
  • Widad University College
  • Quest International University (QIU)

Advertisement

english essay kssm

Studymalaysia References

  • Schools of Malaysia
  • Study Malaysia
  • Postgraduate Malaysia
  • Training Malaysia
  • Challenger Concept Publications

Articles in Spotlight

About this website.

Copyright © 1998-2024 Webway E Services Sdn Bhd (510678-U). 60-3, Jalan PJU 1/3B, Sunwaymas Commercial Centre, 47301 Petaling Jaya, Selangor, Malaysia. Tel/Fax: +603-7880 3837 Whatsapp: +6014-669 3837 [email protected]

Writing Component

 
This topic will give you some knowledge about essay writing and its format. 
 
   
 
         
  Part 1 : Short Communicative Message  
         
  Part 2 : Note Expansion  
 
 
  • You need to write an essay of about 80 words based on the stimulus given. The essay can be an email, a short letter, a brief note, or a brief description.
  • Aim of the message:
  • To make a choice
  • To persuade
  • To express an opinion
  • To accept or decline an invitation
  • To complain
  • To describe
  • To give information
  • To give suggestions
  • Here are some tips and techniques that can be used to answer this part:
  • Read the question carefully.
  • Identify the reason why you should write the message.
  • Identify your target audience.
  • Check whether the tone should be formal or informal.
  • Be concise, clear, and straight to the point.
  • Write in paragraphs.
  • Check your spelling, tenses, and punctuation.

From:

Subject: Opinion needed

Hello,

    My parents have organized a family trip to Kundasang. I feel that I may be bored and have decided to bring my phone to play online games. However, my dad is asking me not to take the phone but to take my collection of indoor board games.

    Let me know whether I should follow my dad’s suggestion.

From:

Subject: Follow your dad’s suggestion

Hello Lily,
    Great news to know that you are going on a family trip with your family.
    In my opinion, you should follow your dad’s suggestion and take along the board games. Board games will enhance the closeness and harmony among your family members.
    Moreover, there will be lots of shared laughter and jokes while playing the board games. You will have more fun.
    If you take the phone, you will be playing online games alone and this will defeat your dad’s reason for a family trip.
    This is my opinion. Have a great trip. Bye.

 

  • In this part, the writing can be one of the following:
  • Processes & Procedures
  • Letters (Informal & Formal)
  • Stories (Narrative, descriptive)
  • Below are some format of the essays writing:
  • People write emails to exchange digital messages using digital devices such as computers and mobile phones.

To:

From:
Subject: Dragon Dance
Hello Jaiver,

    I would like to share a special event that happened at my office today. My company had organized a Dragon Dance procession five days after Chinese New Year. Most of my colleagues are Chinese.

    At 3 p.m., the Dragon dancers came in a lorry. They danced in front of the building and entered the office to bless us with prosperity and good luck. My manager gave the dancers red packets of money called ‘ang pow’. I was amazed at the special skills of the dancers as they jumped high up in the air and twirled around like a real dragon. (Continue...)

    I’m happy that this special event has promoted goodwill, harmony, and integration among all the races. Bye for now.

 

Regards,

 

 
 

 
 

 
 

34, Jalan Puri,

Taman Warisan,

65790, Petaling Jaya.

6 Mac 2021.
   
Dearest Alice,
   
 
 
 

 
 

Maya Aisyah,

No.3, Taman Jaya,

89790, Petaling Jaya.

   

The Principal,

SMK Jaya, Taman Jaya,

89790, Kuala Lipis,

Pahang.                                                                                                                                                               23 MAC 2021. 

   
Dear Sir, 
   
Unsatisfactory Service of The School Canteen
   
 

Chapter : Writing Skills

Topic : essay, related notes.

  • Prepositions
  • Subject-verb agreement
  • Conjunctions

english essay kssm

Challenge your friend in timed Quiz battle

Edit content

Malaysia Students

Enter your email address to get ★ FREE Malaysia Scholarships 2020 ★ Post your advertisements for free here!

  • Shop Discount Promo
  • Ask Question & Get Help
  • Rent a Room
  • Scholarships
  • Part Time Jobs
  • Write & Get Featured
  • Buy Bus Tickets

Thursday, June 26, 2014

46 good spm english model essays / free essay samples for o-level, ielts, toefl & muet writing.

46 Model Essay Samples for SPM English, O-level, IELTS, TOEFL & MUET Writing

        descriptive essays.

  • My Best Friend
  • Describe an afternoon at the bus station
  • A Horrifying Swim
  • A Prominent Malaysian Leader
  • A Demonic Gold
  • My Favourite TV Programme
  • The Night Market

Narrative Essays

  • A Horror / Tragic Story
  • Finally, A Voice Message
  • That is the reward for my patience and hardwork
  • A Holiday I Would Never Forget
  • Couple Foils Robbery Attempt
  • Write a story starting with: “The widow had to work hard to bring up her little son alone...”
  • My Most Embarrassing Situation
  • A Road Accident
  • Autumn on Sugarbush Street
  • Of Bombs and Ice-Cream

Argumentative / Persuasive Essays

  • Haze: A Danger to Health
  • Cell phones - One of Our Greatest Technologies Misused
  • Importance of Studying English

Reflective Essays

  • Are undergraduates ready for the real world?
  • Does School Prepare Us for Life
  • What would you do if you had a lot of money

Factual Essays

  • Social Networking Website

Directed Writing

  • Anti-Smoking Campaign Speech
  • Informal Letter
  • Informal Letter Sample
  • Formal Letter: Letter of Application
  • Formal Letter: Letter of Complain
  • Complain Report About School Canteen
  • Book Report
  • Police Report on Accident

english essay kssm

48 comments:

Is there any chinese language essay?? can recommend??

lol u retarded?

Why are you so mean? Which part of it is retarded?

Maybe he lack of attention in his life

Dude, there are really chinese essay in spm. What's wrong with you guys

Are you lost mate? This webpage is for english essays, not chinese retard

Cmon he just asking if theres any chinese language essay... nothing wrong with it... sorry i think u are the one who is retarded here... no one r supporting ya...

what is naratif composition

english essay kssm

Lol retarded 9 yr olds hating over a single question

WTH????? He is just asking. FGS he is not even asking u man..That question were asked to the admin. Pls just mind your own bussiness..

Senyap ar semua

Ahaha. Retarded indeed.

Ni nk buat rujukan ke gaduh?

Spm around the bout

guys i think,personally that this site helps you a lot in your studies.Amazing essays which are wonderfull

This is a fabulous site , helps me a lot😍

hey there.. im just here looking through the comments

i honestly thought that no one gonna be on this blog in 2021

bunch of pointless people arguing about an idiot

The test score works as a proof of their language proficiency and knowledge. Finding the Best TOEFL Coaching it self is a task because the objective of TOEFL classes is to give you interactive examples of TOEFL test questions.

Good Work for English learnes

This is important to remember while you are browsing IELTS or TOEFL preparation course, if you are planning on applying for citizenship or collage and intend to use your results as an entry requirement.

klau tuk repeat bi spm ngan st ada x ?

After attemting for my IELTS five times I had to get professional help and nothing like enrolling in Insearch I had an amazing support team that helped me clear and achieve my required target.

The MBA is a master's degree in business administration which helps people attain a better understanding of the scientific approach in management.

With such programs it will be more easy for the students to get the good writing ideas and the techniques, looking forward to most important among them.

Transferring to a four year university may actually be a cheaper way to get a high quality education. This article provides tips for students who wish to transfer in.

That's really huge list of sample essays for students those need to write essay and facing difficulties. I am sure that will be very helpful for students studying in various level.

To be honest All the 46 Model essays are uncomparable to the O level English Standard. In fact,writing such a essay in o level english will guarantee a fail

Woah,these essays are actually good for SPM level. Seeing this comment,I wonder how am I going to survive after SPM with my own level of English. HUhu..T-T

totally useful for me

thank you much for the God's sake who had done this blog :) You pretty had aid me much in essays

thanks for the essay samples! I was struggling what I want to write about for my mid term examination.. But not anymore :)

Hey I would like to get in touch with you about publishing one of my articles here? Any way to do that??

Click here for email address to submit your article.

Thank you for sharing. This is a good material for the development of creative thought. I'm writing an essay for more than five years. Sometimes creative crisis comes. In this moment you need to distract yourself with other thoughts. Good luck to all with essay writing.

Oh, thanks! It is very useful information! Right now I have to write an essay. But I haven't decided yet will I write it alone or with the help of this writing service.

Thank you for the useful samples of the essay. But if we are talking about the uniqueness of I prefer this service. Cuz the professionals guarantee the quality of written works. In addition, I like the price and the system of discounts. So I advise you!

Do you have any doubts on the result of online writing service? Visit us and learn more about our reliable writing service and eliminate all the fears you have. Take professional help and relax!

Any spm 2020 candidates here?. How's your life going?. Mine is cursed

Same and im goin through mid year exams rn...smh

Me, a 12 year old that wants to write longer than the word limit in primary school: wow, this is cool

Malaysia Students Blog is a team blog on Malaysian major examinations, secondary, pre-university & tertiary education, scholarship Malaysia , student resources, students' thoughts and everything relating to students & undergraduates at schools, colleges & universities in Malaysia - Student Education Malaysia Comment Policy: Comments posted at Malaysia Students blog should be on-topic, constructive and add value to the discussion . Comments that are off-topic, one-sentence, abusive or offensive will be removed. Please use proper English with correct spelling and grammar in your comment. For general questions, please post them at SPM Student Malaysia . For enquiries, please email the administrator of this blog: Student at Malaysia-Students dot com.

Join over 50,000 people who get FREE latest scholarship updates via email!

Do not miss any job offers get student part time jobs via email.

Battle

  • Classes List
  • Assignments
  • Learning Hub
  • Quick Notes
  • Experiments
  • Google Android

element 02

English Form 2 Notes

english essay kssm

Chapter 3 : Reading Skills

english essay kssm

Chapter 4 : Writing Skills

english essay kssm

Assess yourself by staged practices

Notification Bell

Email form 4 Guided Writing

Profile picture for user teacherYan

WAN NORIAN WAN OMAR

Guided Writing. Email. Form 4 KSSM

Loading ad...

  • Google Classroom
  • Microsoft Teams
  • Download PDF

Email form 4 Guided Writing

  • Quick Upload
  •   Contact Us
  •   FAQ
  •   Help Document
  • Help Document

buku teks t5 kssm

  • http://anyflip.com/bitrl/fvhn/

Related Publications

FORM 5 ENGLISH TEXTBOOK KSSM

1 It’s personal! Read the descriptions of different families and label them with these words. Which one is most like your own? adoptive family blended family extended family single-parent family traditional family 1 I live in Bristol with my mum, dad and brother, Tim. My parents met at university and got married when they finished their studies. I was born a year later and my brother was born when I was three years old. 2 Mum and I have just got home from holiday in Spain. Mum works hard so that we can go away once a year. It may sound strange, but I have a lot of fun with my mum. There’s just the two of us at home, so it’s a good thing we get along! 3 My dad remarried a few years ago and when he did, Josh and I got a stepmother and a stepsister! At first, it was strange living with them in the same house, but we soon got used to it. It’s pretty cool, actually. 4 Every summer, the whole family gets together for a party at my grandparents’ house. All three generations are there – grandparents, aunts, uncles, cousins and everyone. We have a fantastic time. For me, it’s the best day of the year! 5 My mum and dad aren’t my biological parents. They couldn’t have children of their own, so they adopted me and my sister! They love us very much and always do their best to make us happy. DVD 1 Watch this short video of children talking about their brothers and sisters. What kind of family is Elizabeth from? 5 Reading 1 L ook at these household chores. Who do you think should do them? Write C for child or P for parent. 1 Make your bed 5 Do the laundry 2 Wash the car 6 Dust the furniture 3 Cook meals 7 Clean the bathroom 4 Wash the dishes 8 Sweep and mop 2 W hich of the chores in 1 do you do? 3 Read the article about helping out at home and decide on the best title for the article. a Top tips for a clean home b When a household falls apart c How to treat teenagers Dirty dishes in the sink, dusty furniture, grubby carpets, filthy floors, unmade beds, overflowing rubbish bins and smelly laundry in the basket. Could you live in such a mess? In the past, women stayed at home and did all of It’s a sad fact that just when children are mature the household chores while men went out to work. enough to really help in the house they become too The father or sons rarely helped, but sometimes involved with their schoolwork, part-time jobs and the daughters did. However, those days are long other activities to be of much help. They always seem gone. 1 But despite this change, many teenagers too busy to lend a hand around the house. Even so, believe that their parents, and more particularly their teenagers should be careful not to make extra work mothers, are the only ones who should pick up, tidy, for others. 2 The truth is that no one is too busy wash, clean and clear. Are you one of those teens? to do these simple chores, and anyone claiming Or do you help out? otherwise is probably just being lazy. So what happens when parents become sick and tired of their 6 children’s excuses? Jessica Stilwell faced this very problem. Her three daughters didn’t lift a finger at home. So she went on strike. It all began on a typically busy Saturday, when Jessica was rushing around all over the town, taking her daughters to and from sports, shopping for the family and running errands. That evening, when she put her feet up for the first time all day, she looked around at the mess in her home and realised, with a shock, that she hadn’t made any of it. Stilwell went on strike there and then, and stayed on strike for six days. 3 Incredibly, they didn’t even notice what was happening until day three of the strike. By 4 Five sentences have been removed from the article. Choose from the When you deal with a gapped text, look for words sentences A-F the one which fits each gap (1-5). There is one extra such as definite articles and sentence which you do not need to use. pronouns in the missing sentences that you think A W hat this means is that they should keep their rooms tidy, leave bathrooms will link to things in the clean, pick up after themselves and wash their dishes once in a while. text. Then, find what those words refer to and place the B Another option was to ask her girls to sign contracts, which clearly outlined missing sentences in the which chores each one was to do regularly. correct place. For example, what do they in sentence C H er daughters complained about the ‘disgusting’ house, but it apparently A and these in sentence E hadn’t offended them enough to clean it. refer to? D Nowadays, women have jobs and successful careers, leaving them little time to deal with the large number of tasks that a household requires. E Interestingly, these are the main reasons parents give for not pressing their children to help at home. F She didn’t actually tell her children; she just stopped doing the chores. 5 Complete the sentences with the correct form of these expressions. be sick and tired do your fair share lend a hand not lift a finger put your feet up run errands 1 Jenny shares a flat with two other university students and they all to keep the place clean and tidy; no one does more or less than anyone else. 2 Jim’s not at home right now; he’s for his dad, but he’ll be back later. 3 I of asking you to clean your room, so there’s no pocket money for you this week! 4 You look exhausted, Terry! Why don’t you and I’ll bring you a nice cup of tea? 5 I’ve got a lot to do today and it would be a big help if you could . 6 While I cooked a three-course dinner, my husband watched TV and ! then, dishes had piled up in the sink, 6 Work with a partner. Imagine you are sharing a flat. dirty plates were still on the dining table and smelly socks were on the bedroom Write a list of household chores that need to be done. floors. 4 It wasn’t until day five that Then discuss each chore and decide who will do what. the girls started to clean up the house, Use the ideas below and some of your own. blaming one another for the mess. During the clean-up, Stilwell sat on the UNIT 1 7 sofa drinking coffee that her daughters had made for her. Stilwell says it was shocking to see how much of what she did for her children were things that they were perfectly capable of doing on their own. She hadn’t asked them to help because she didn’t want to argue with them, or because it was faster and simpler to do it herself. 5 What’s the situation in your home? Do you do your fair share or do you expect others to clean up after you? If your mum or dad went on strike, who would break first, them or you? a-z Vocabulary 1 1 The words in bold are in the wrong places. Write them in the correct places. 1 Molly spends a lot of time with her extended family; she and her parents see her grandparents and other peers regularly. 2 Your strangers are usually people who are the same age and part of the same social group as you. 3 Everyone loves Uncle Joe; he hasn’t got a(n) coach in the world! 4 Our biology teacher is taking my colleagues and me to the Natural History Museum. 5 When you work in a small office, it’s important that you get along with all your classmates. 6 Mr Taylor is my father’s business enemy. They started a record company ten years ago. 7 You should tell your children to avoid talking to relatives. 8 Ms Cooper is our basketball partner. This week she is teaching us shooting skills. 2 Complete the sentences with both words. 1 discuss argue Let’s sit down and this like adults. Why do we have to about things all the time? what he 2 criticise advise If you want a better relationship with your son, I’d you to not does all the time. 3 grumble gossip about the weather whereas my mother loves to Grandma of not being strict enough with me. He says she My father likes to about the neighbours. 4 praises accuses Dad often me no matter what I do. 3 C omplete the words related to different kinds of feelings. Write a vowel (a, e, i, o, u) on each line. 1 M y parents never listen to what I have to say. I feel so fr str t d! 2 N ancy got angry and shouted at her d of grandfather. Now she feels sh m her behaviour. 3 If you want to get along in this company, you must be r sp ctf l towards everyone you work with. 4 A unt Marge is always smiling and laughing. She’s such a ch rf l person. 5 M um and Dad are usually very c lm people, but they do get angry if they think I’m not trying my best. 6 Why do you never help out with the chores? Don’t you feel g lty when your mum does everything? 7 T ony had an argument with his best friend and now he isn’t talking to him. He feels m s r bl . 8 J anet’s family was very pr d of her when she came first in her class. 8 Grammar 1 Present simple, present continuous, stative verbs 1 R ead about the uses of the present simple, the present continuous and stative verbs. Present simple • plans and arrangements (future) • facts and permanent situations She isn’t seeing her friends tomorrow. I live in a big house with my extended family. • general truths and laws of nature Stative verbs The sun sets in the evening. Stative verbs describe states (not actions). • habits and routines Common stative verbs talk about feelings, We always visit New York in the summer. emotions, the senses, states of mind and • timetables and programmes (future) possession. We do not use them in continuous My partner’s plane arrives at five o’clock. tenses. • reviews, stories and sports commentaries My mother hates doing household chores. The story is about a young girl and My colleagues look very cheerful today! her friend. Some experts believe peers are more important to Present continuous teens than family. • actions happening at the time of speaking However, some verbs can be both stative and Dad is making dinner in the kitchen. action verbs, but with a change in meaning. • temporary or changing situations My baby brother appears to be sleeping. My cousin is staying with us for the holidays. (present simple = seems) My classmates and I are appearing in a play She is becoming more and more frustrated. about relationships. • annoying habits, often with adverbs like always My coach is always criticising me. (present continuous = performing) 2 Complete the sentences. Use the present simple or the present continuous. In which sentence could you use both, but with a change in meaning? a I (see) my friends at the gym. b My colleagues and I (discuss) the new project right now. c I (usually ask) my coach for his advice. Read 1.1-1.3 of the Grammar Reference before you do the tasks. 3 Complete the sentences. Use the present simple or the present continuous. 1 (you / understand) why teens think their peers are important? 2 My teacher (always criticise) me! It drives me crazy! 3 Mum and Dad (not give) my brother and me money for cleaning our room. 4 At what temperature (water / freeze)? 5 We 6 In this story, Papa Bear (have) a huge get-together for all our relatives on Sunday. 7 My colleagues (sit) in his chair first. 8 (not work) this weekend. (your son / ever talk) to strangers? 9 (you / cook) supper for your family every evening? 4 Circle the correct words to complete the text. Teens and pocket money Some parents complain that their children 1 are always asking / ask always for money. Many teens 2 get / are getting pocket money for helping with chores around the house and the amount of money they earn 3 increases / is increasing regularly. This is because things 4 are becoming / become more and more expensive all the time. Parents of teens 5 are often worrying / often worry about whether they should give their children pocket money and if they choose to do so, they 6 usually have / are usually having a hard time deciding how much to give them. It 7 seems / is seeming that there really is no ‘correct’ amount. One way for parents to decide how much to give their children is to ask other parents what they 8 do / are doing when it comes to pocket money. Many of them will say that they 9 provide / are providing their children with a certain amount of money each week. If their children 10 are wanting / want to buy something special, they can save this money until they have got enough or they can do extra chores around the house for a few weeks. UNIT 1 9 a-z Vocabulary 2 Collocations & Expressions 1 Complete the sentences with the correct form of do or make. 1 My sister and I always time to visit Grandma at the weekend. 2 I cooked breakfast, so you can the washing-up. 3 Sally likes to help out, so she lunch or the evening meal on Saturdays. 4 We can’t believe it. My brother offered to the laundry while we were at the supermarket! 5 After I the beds, I’ll sweep the floor. 6 If Fran chores around the house, her parents give her pocket money. 7 Mum and Dad the housework at the weekend because they are both at work during the week. 8 Don’t trouble ... go and lend a hand in the garden. Phrasal Verbs 2 Circle the correct words to complete the sentences. 1 M y dad just remarried and I’m pleased to say that my new stepmum and I get along / get by really well. 2 I believe family is important, so I get back at / get together with my relatives whenever I can. 3 M y wife has been grumbling a lot recently. I think we should go away / go out on holiday for a few weeks. 4 Steven has fallen out / fallen apart with his best friend. He seems very upset. 5 W hen Mum went on strike, the dishes piled on / piled up in the sink and the flat got very messy. 3 N ow match the phrasal verbs you didn’t use in 2 with the meanings below and then write a sentence using each one in your notebook. 1 : take revenge on 2 : increase something by a large amount 3 : manage to live or achieve something with difficulty 4 : break up into pieces 5 : leave the house to go somewhere Word Formation 4 Which ending do we use with each word below to form an adjective? Make the necessary changes to form the adjectives and use them to complete the table. apology biology dust fantasy filth option person reality smell -y -ic -al 1 47 2 58 3 69 5 Now complete the sentences with some of the words from 4. 1 Joey was very about missing his parents’ wedding anniversary. 2 Let’s be . It would be impossible for me to clean this huge house all by myself. 3 That laundry in the basket is getting . I’ll put it in the washing machine after work. 4 I’ve got a(n) family! We all help each other with our problems. 5 Maria, your shoes have got mud all over them. They’re ! 6 Doing chores is not in my house. We help out or Mum goes on strike! 10 Grammar 2 Relative clauses 1 Read about relative clauses. Relative clauses give us more information about the subject or the object of a sentence. They are introduced by the following relative pronouns: who, whom, which, that, where, why, when, whose. The little girl who/that I look after during the day is adopted. The laundry which/that is in the basket is filthy. That’s the place where my father met my stepmother. That is the reason why Joe is grumbling. That was the time when I had an argument with my brother. This is the woman whose daughter does our housework. Defining and non-defining relative clauses Prepositions in relative clauses • A defining relative clause gives us important • Prepositions usually come at the end of the information which we need in order to relative clause. They can also come before the understand the meaning of the main clause. relative pronoun, but this makes the sentence The chore which/that I hate most is the sound very formal. washing-up. (The sentence would not make H is books about relationships, for which he is sense without which/that I hate most.) famous, sell very well. (very formal) • When who, whom, that and which are the His books about relationships, which he is objects of a defining relative clause, they can famous for, sell very well. (more common) be omitted. • We cannot use a preposition before who or that. The men who/that I invited to the get-together We can use one before whom, but that makes are my uncles. the sentence sound very formal. The men I invited to the get-together are The woman who/that I was talking to is my wife. my uncles. The woman to whom I was talking is my wife. • A non-defining relative clause gives us extra (very formal) information which we do not need in order to • When the preposition is before the relative understand the meaning of the main clause. We pronoun, we cannot omit the relative pronoun must use commas to separate a non-defining even if it is the object of the relative clause. relative clause from the main clause. I s this the project which/that you won the Molly, who often gossips, doesn’t get along with prize for? her peers. Is this the project you won the prize for? • We cannot use that in a non-defining relative Is this the project for which you won the prize? clause and we cannot omit the relative pronoun. (which cannot be omitted) 2 Read these sentences and underline the relative clauses. Which sentence means that the speaker: • has more than one brother and that the one who has written a book lives in Scotland? • only has one brother and that he has written a book and lives in Scotland? a My brother, who has written a book on personal relationships, lives in Scotland. b My brother who has written a book on personal relationships lives in Scotland. Read 1.4-1.7 of the Grammar Reference before you do the tasks. 3 Circle the correct words. Learning about relationships The book Impression Management, 1 which / that is about the different relationships between people, was written by Barry R Schlenker, 2 whom / who is an American professor. The main reason 3 why / which Schlenker wrote the book was because he felt that people should have more information about relationships. The main idea of the book, 4 who / which argues that people try to control how others see them in almost every social relationship, was not particularly popular in 1980, 5 where / when the book was first published. However, in the universities and colleges 6 where / that the book was taught, there were many students 7 that / whom felt that Schlenker’s thoughts on relationships were important ones 8 that / to which people should learn about and discuss. Much of the support 9 - / where the book received, 10 for which / that Schlenker was very thankful, came from his own students. He was also very thankful to his wife, parents and colleagues 11 - / whose advice and encouragement helped him greatly. At the beginning of the book, Schlenker says that it was these people and these relationships 12 why / which made the production of Impression Management possible. UNIT 1 11 Listening 1 Match the phrases 1-10 with the phrases a-j which have a similar meaning. 1 have a nice chat a organise things to do 2 do voluntary work b stop doing something 3 get a lot out of something c do helpful tasks without being paid 4 plan activities d deal with something 5 have something going on e be busy doing something 6 have courage f talk in a friendly way 7 give up doing something g show that someone is not guilty of a crime 8 see the best in something h enjoy and see the benefits of something 9 prove someone innocent i be brave or not afraid 10 cope with something j focus on the good parts of something 2 W hen we admire someone, we can say that they have qualities which are admirable. Which of the following qualities do you think are admirable? Put a tick or a cross. 1 having patience 5 making trouble 2 having courage 6 gossiping 3 arguing a lot 7 being generous 4 listening to people’s problems 8 worrying a lot 3 You will hear five short extracts in which people are talking You probably won’t hear the same words on the recording about the person they most admire. For questions 1-5, choose that you read in the list A-G, from the list (A-G) what qualities each speaker admires in the or if you do, they might not be person they are describing. Use the letters only once. There are spoken by the right speaker. two extra letters which you do not need to use. You must listen carefully to what each speaker says rather than A overcoming a lack of confidence 1 focus on the words you read. B always seeing the best in people 2 For example, Speaker 2 starts C finding happiness through kindness to others 3 off by saying I’m not a very D being well-organised and busy 4 confident person ... , but goes E having the courage to follow your dreams 5 on to talk about her cousin who F coping well at a difficult time is much more confident. Which G being patient with younger people item on the list A-G might you think is the answer if you’re not listening carefully? 12 Speaking 1 Ask and answer these questions with a partner. • Which relative or friend do you admire most? Why? • Did you meet most of your friends at school or in other places? • Do you spend most of your free time with your friends or your family? Which do you prefer? 2 W hen someone asks you for your opinion about something that is worrying them, it’s important to be polite and show understanding when you answer. Put a tick against these sentences if they are polite and understanding, and put a cross if they are not. 1 Well obviously you should ...! 5 In my opinion, you should ... 2 I think it might be best to ... 6 ... is a terrible idea. 3 If I were you, I’d ... 7 It’s a difficult decision, but ... 4 I can’t believe you’re considering ... 8 You’re not really going to ..., are you? 3 Follow the instructions and complete the task with your partner. One of you will be Student A and the other will be Student B. Use the words and phrases in the Language Bank to help you. Student A: Look at the pictures and use the information on page 188 to answer Student B’s questions. Student B: Look at the pictures and ask Student A these questions to find out what the situation is. You should ask: What is the problem? What are some possible solutions? What are the disadvantages of each solution? Using the information you have been given, give Remember that there is no right or wrong answer and the Student A your advice on what you think the best person in the situation is having difficulty deciding what solution is and why. Explain why you didn’t choose the to do. Therefore you should show that you understand other solution. the problem and explain politely how you made your decision and why you didn’t choose the other solution. 4 Now swap roles. Look at the Extra Practice on page 188 and follow the instructions. 5 Work in pairs to discuss these questions. Showing understanding I understand your problem, but I’d probably ... • What qualities do you think are important for It’s difficult to decide, but ... making and maintaining friendships? Both options have advantages and disadvantages, but ... It’s a difficult decision, but ... • D o you think it’s more important to have lots of I think in your position that I might ... friends or a few good friends? UNIT 1 13 • There is a popular proverb in English that says ‘Blood is thicker than water’. What do you think it means? Do you agree? Writing Email: Reading the task carefully It is important to read writing tasks carefully so that you know exactly what you have to do. If you hurry through all the details, you could answer incorrectly. The details are there to help you understand important points: the situation you are in, the reason you are writing, the topic you have to write about, and the type of language you should use. 1 Read this writing task and answer the questions below it. You have received an email from your English-speaking friend. I have to write about personal relationships for a class project. Can you help by telling me about your most important relationship? Who is it with? What is he or she like? I don’t want to be nosy, but can you also explain why the relationship is important to you? Write soon, Mary Write your email. (140-190 words) SITUATION: 1 W ho has sent you the email? 2 What does she have to do? REASON: 3 Why are you replying? a to tell her news b to give her information c to give her advice TOPIC 4 What is the main thing you have to write about? 5 What points do you have to include? LANGUAGE 6 W hat relationship do you have with the person you are writing to? 7 Is a formal or informal writing style best? 2 Read this writing task and answer the questions. You have received an email from your English-speaking friend. 1 Ask yourself questions 1-7 in 1, Our teacher has asked us to prepare a talk on what underlining any words in this task that you think might be useful while you are young people in different countries do when they are not planning or writing. at school. Can you help by writing and explaining what 2 Tick the two writing skills you will mainly it’s like in your country? What do young people do at need to answer this email? home? Where do they go out and what do they do there? expressing an opinion Thanks! explaining Billy describing Write your email. (140-190 words) suggesting 3 R ead this email that was written in answer to the question in 2. Which two of the following phrases are the most suitable for ending the email? I look forward to your reply. Have a good time. Good luck! I hope I’ve helped. 14 From: Nick Jones 4 T he writer uses a separate paragraph in her email for each new Opening paragraph It was great to get your email. topic to make it easier for the reader to follow. In the email in 3, It looks as if you’re busy find and underline the words that tell us the topic of paragraphs 2 right now! and 3. Which set phrases has the writer used to introduce them? Your news sounds ... I hope ... 5 W hen you expand the topic of a paragraph, use linking words in Introducing topics (informal) the sentences that follow to add the new information. Which linking To start with, ... First of all, ... words have been used in paragraphs 2 and 3? Circle them. As for..., When it comes to ..., 6 Now look at these linking words. Are they formal (F) or informal (I)? Lastly, ... 1 in addition, 4 apart from that, Linking information (informal) 2 besides that, 5 as well As well as ... 3 moreover, 6 furthermore, ... as well also 7 Read this writing task and WusheenthyeopulahnavaenfdintihsheeLda,ncghueacgkeyoBuarnkwotork too help you write your email. besides/apart from that, otherwise though carefully. Routine You have received a letter from your English-speaking penfriend. always, usually/normally, often, sometimes, rarely, hardly ever Meals Everyone gets their own food ready. make/cook a meal/lunch/dinner grab a quick snack eat in front of the TV sit round the table serve a meal around 8 o’clock Housework do chores/the housework lend a hand do the washing-up do the laundry dust/sweep/mop/clean Leisure time chat, discuss, argue share the same interests/hobbies/ pastimes be interested in (something) spend time together (doing something) enjoy doing (something) I’m doing a social studies course at college and I’ve got a project to do about family life. Can you help? Could you tell me about your normal family routine at home: meals, housework, and how you spend leisure time together as a family? I just need you to explain things and tell me what usually happens in your house. Love, Tim Write your email. (140-190 words) Plan Read the writing task carefully and underline important points so Paragraph 1: Comment on Tim’s email to you. you can check back quickly. Make your writing easy to read Say how you feel about helping him. by introducing the topic in the first sentence of each paragraph. Use Paragraphs 2-4: Introduce paragraph topic. linking words for each piece of information you add. Give information, using linking words. Paragraph 5: Comment on his project. Say you hope you have helped. UNIT 1 15 1 Reload Vocabulary Grammar Choose the correct answers. Choose the correct answers. 1 I’ve got lots of ____, but I think Aunt Paula and Uncle 1 Her songs about love, ____ she is very well-known, Joe are my favourites. are fantastic. a enemies a which b partners b for which c classmates c that d relatives d for that 2 Some people say that ____ are just friends you 2 My sister ____ in a school play tonight. Do you want haven’t met yet. to come? a peers a is appearing b strangers b appear c coaches c does appear d colleagues d appears 3 You worked hard all day, Mum. Sit down and ____ 3 Feeding a big family healthy meals ____ more and while I get dinner ready. more expensive. a do your fair share a get b put your feet up b is getting c be sick and tired c gets d run errands d getting 4 My best friend ____ me of breaking her iPod, but I 4 ‘Can Billy come out and play?’ didn’t! ‘No, he ____ his mother do the chores right now.’ a accused a is always helping b argued b helps c discussed c does help d advised d is helping 5 I passed all my exams, so my parents are very ____ 5 ‘____ your grandparents this summer?’ of me. ‘Yes, and I can’t wait!’ a proud a Are you visiting b calm b You are visiting c ashamed c Do you visit d cheerful d You do visit 6 Parents should always ____ to talk to their children 6 I’m going to the airport to get Jane. ____ at three about their problems. o’clock, so I’d better hurry. a do time a Her plane arriving b make chores b Her plane arrives c do chores c Is her plane arriving d make time d Her plane does arrive 7 My family isn’t wealthy, but if we’re careful with our 7 ‘Do you know the tall man with the red hair?’ money, we’ll get ____. ‘Yes, he’s the man ____ brother built our house.’ a by a that b along b which c back at c whose d together with d who 8 Since Mum went on strike, the dishes have been 8 ‘What’s the matter, Steven? ____ miserable.’ ____ in the kitchen sink. ‘I’ve just had an argument with my best friend.’ a falling out a Are you looking b falling apart b Do you look c piling up c You look d piling on d You are always looking 9 When a young person does something well, you 9 ‘Can I go to the match with Stella?’ should ____ them for it. ‘No, and the reason ____ you can’t is because you a grumble haven’t done the washing-up.’ b gossip a which c praise b why d criticise c when d where 16 2 Life’s Great Mysteries 1 Look at the main picture. What is this place? Is it scary? Why? Find these things in the picture. crow full moon grave spirit 2 Read about these mysterious places and match the photos to the descriptions. AB C 1 Area 51 2 Teotihuacan 3 The Bermuda Triangle This place is a military base in Located near Mexico City, Teotihuacan This is a mysterious area of the USA. Some people believe was an important city. People lived the sea off the coast of Florida, it is the top-secret site where there for more than 700 years, but where thousands of ships the bodies of aliens and some then they left suddenly. We don’t and planes have vanished of their technology were know who built it or what they called over the centuries. Are the taken after a UFO crashed it. Later it became important to the disappearances due to natural in Roswell, New Mexico in Aztecs, who gave it its name, which, disasters, strange magnetic 1947. according to legend, means ‘the place forces or aliens? where the gods were created.’ DVD 2 Watch this short video about the Bermuda Triangle. Which three places does the triangle connect? 17 Reading 1 Do you believe in these creatures? Tick the ones you believe in. 1 ghosts 5 unicorns 2 aliens 6 werewolves 3 vampires 7 fairies 4 witches 8 mermaids 2 D o you think some of the creatures in 1 are more likely to exist than others? Which ones? 3 Read the article about a strange house. Which of the ideas in 1 are mentioned in the text? A house of mystery In 1884, heartbroken Sarah Winchester left her and over the next thirty-eight years, she employed home in Connecticut on the east coast of the USA builders around-the-clock to add on room after as well as the graves of her husband and only child, room, and storey after storey. The building work and travelled across the country to California where never stopped, not even for weekends or holidays a strange obsession awaited her. Did she know that it would last for the rest of her life? and it produced the house known today as the Winchester Mystery HouseTM. It originally When her husband passed away, Sarah had seven floors, but after an earthquake inherited the Winchester gun and in 1906 it was reduced to four. Apart rifle company, which had made the from the house’s strange architectural Winchester family very wealthy. After features including a staircase that the deaths of her child and husband, leads up to the ceiling, doors that Sarah fell into a deep depression open onto walls and secret passages and decided to consult a medium. that run between rooms and behind According to some sources, the walls, it was also unusually large. medium explained that her family At the time of Sarah Winchester’s was being haunted by the ghosts of death, it had 160 rooms, 2,000 American soldiers and others killed doors, 10,000 windows, 47 staircases by Winchester rifles. Supposedly the and 13 bathrooms! deaths of her daughter and husband had been caused by these spirits and Sarah Winchester had strange habits, Sarah Winchester might be the next victim. too. Apparently, she never slept in the The medium said that to keep the ghosts same bedroom two nights in a row because happy, Sarah had to build a huge house for them. she wanted to confuse any evil spirits that were As long as she never stopped building the house, waiting for her. She also used to visit the Blue her life would not be in danger. Room at the centre of the house every night to communicate with the good spirits. She would Sarah left Connecticut for California. There, in ring a bell at midnight to call them and again 1884, she bought a small unfinished farmhouse at 2 am when it was time for them to leave. She 18 Try to answer multiple-choice 4 R ead the article again and choose the best answer questions in your own words before you are distracted by A, B, C or D. seeing the answer options. Once you think you know the 1 What does ‘it’ at the end of the first paragraph refer to? answer, look at the options. If A travelling you see the answer that you B California anticipated, circle it and then C Sarah’s life check the text to be sure that D an obsession it is the correct answer. 2 According to the medium, why did Sarah’s daughter and would wear one of 13 special coloured husband die? robes and ask them for guidance on her construction plans. A The ghosts of gun violence had killed them. A year after Sarah’s death, the house B They were very depressed about the war. was opened to the public. Since then, C So that Sarah could make the ghosts happy. many people have described strange D Both had been shot dead by soldiers. experiences there. Neighbours claimed to hear a bell ring at midnight and at 2 am. A 3 What did Sarah Winchester find in California? caretaker heard the sound of a screw slowly A a house with seven floors turning, then hitting the floor. He looked B a house she could continue to build everywhere, but found nothing. Tour guides C a house full of mysteries have reported seeing a ghostly workman D a house damaged in an earthquake with a dark moustache in the basement of the house. 4 What are we told about the Blue Room? Is the house truly haunted? No one can A Sarah kept her clothes there. say with any certainty, but it is a fascinating B Bad ghosts were unable to enter the room. story and the Winchester Mystery HouseTM C She went there to get advice. is still open for visitors who want to find out D Sarah sometimes slept there. for themselves. 5 What happened at the house after Sarah died? A There were unexplained events. B Guides had strange visitors on the tours. C Workmen continued to build on it. D People were too scared to visit it. 5 Circle the correct words. 1 An obsession is a strong pain / passion you feel. 2 A medium looks for / makes contact with dead people. 3 The word ‘spirit’ is another name for a ghost / monster. 4 A victim is someone who suffers / causes a bad experience. 5 A passage is an entrance / a narrow corridor in a building. 6 An incident is an event / a project. 6 Read about the incident below and choose the ending that you think was most likely. How do you think you would react in the same situation? Write a dialogue between you and the ghost of a famous person. Legend has it that while spending a night at the White House in 1942, Queen Wilhelmina of the Netherlands was woken by a knock on the bedroom door around midnight. Answering it, she saw the ghost of former US president Abraham Lincoln staring at her from the hallway. How do you think Queen Wilhelmina reacted? a She wanted to have a conversation with him. b She thought it was a practical joke and laughed. c She was so terrified by the sight that she fainted. UNIT 2 19 a-z Vocabulary 1 1 Complete the sentences with these words. aliens archaeologist evidence historians myth practical joke spirit theory 1 A king was killed in that old castle. Legend has it that his walks the halls at night! 2 I won’t believe that story unless you can give me some . 3 There is a(n) about why Sarah Winchester built her strange house. 4 It wasn’t really a ghost you saw; Jerry was playing a(n) . 5 study and write about important events from the past. 6 Does Tim really believe that little green live on Mars? 7 My father is a(n) . Last year he found some ancient bones in the Egyptian desert! 8 My favourite Greek is about a man called Icarus who flew too close to the sun. 2 Look at the words in bold in the sentences 1-6 below. Then match them with their meanings a-f. 1 I ’m not going in that old house! Everyone knows a silly or stupid that it’s haunted. b frightening c d ifferent from what is normal 2 D id you hear those sounds in the attic last night? They were very spooky. or ordinary d visited or lived in by a ghost 3 I can’t explain the dog’s bizarre behaviour. Why e wonderful; amazing is it running around the house? f very strange 4 Nobody wants to kill you ... don’t be ridiculous! 5 T he pictures painted on the walls of the cave were remarkable. 6 The house is unusual. It’s got stairs that go up to the ceiling! 3 Choose the correct answers. 1 When you solve a mystery, you a find an explanation for it. b can’t understand it. 2 You inherit something a when someone is still living. b after someone has died. 3 When you prove something, a you show that it is true. b you show that it is successful. 4 If you investigate a crime, you a get into trouble with the police. b try to find out who did it. 5 If you observe something, you a forget to do it. b see and notice it. 6 If you discover something, you a are the first person to find it. b are the first person to make it. 7 If something confuses you, you a want to have it. b don’t understand it. 8 When something disappears, you a can’t see it. b can hear it. 20 Grammar 1 Past simple, past continuous 1 Read about the uses of the past simple and the past continuous. Past simple Past continuous • something that started and finished at a stated • actions that were in progress at a stated time time in the past in the past They investigated that crime two years ago. The historian was reading a book at five • past routines and habits o’clock last night. The archaeologist often visited Egypt. • two or more actions that were in progress at • situations or states which were true in the past, the same time in the past but are no longer true I was watching a spooky programme while my Tony believed in ghosts when he was a child. brother was doing the laundry. • actions that happened one after the other in • giving background information in a story the past, for example when telling a story The sun was shining and John was walking in Dean opened the door of the haunted house, the forest. went inside and walked slowly up the stairs. • an action that was in progress in the past that • past actions which won’t happen again was interrupted by another. Homer wrote many stories about the ancient We were talking about our theory when we Greeks. observed something remarkable. Note: Remember that we do not usually use stative verbs in continuous tenses. 2 Read the sentences and identify the main verb in each. Which tense is used? Which sentence is incorrect? Why? a Tom was wanting to find proof to solve the mystery. b Tom was looking for proof to solve the mystery. Read 2.1-2.2 of the Grammar Reference before you do the tasks. 3 Circle the correct words to complete the sentences. 1 Peter wasn’t watching / didn’t watch a scary programme at seven o’clock yesterday. 2 Alfred Hitchcock was directing / directed many remarkable films. 3 Every year, Pat brought / was bringing me a mysterious box and we were opening / opened it together. 4 Lara read / was reading a book of myths while Tyler surfed / was surfing the Net. 5 Did they solve / Were they solving the mystery in 1990? 6 Tom knew / was knowing about the bizarre event. 7 The spirit was coming / came out of the castle, walked / was walking down to the lake and disappeared / was disappearing. 4 Complete the text. Use the past simple or the past continuous. Pandora’s box According to the Greek myth, there once 1 (live) a man called Hephaestus. One day, while he 2 (work), Zeus 3 (tell) Hephaestus to make him a daughter. He 4 (listen) to Zeus, 5 (make) a beautiful woman and 6 (name) her Pandora. Zeus 7 (send) Pandora to marry Epimetheus, who was the brother of Prometheus. Prometheus had given people the gift of fire and Zeus 8 (want) to get revenge. Zeus 9 (give) Pandora a box and 10 (order) her never to open it. However, Pandora was very curious, so one night while her husband 11 (sleep), she 12 (open) the box and all kinds of terrible things came out: hate, crime, disease ... . When Epimetheus 13 (wake up), Pandora 14 (cry). She 15 (open) the box to show Epimetheus it was empty and he 16 (see) a small insect inside. ‘My name is Hope,’ it said. Hope 17 (thank) Pandora for opening the box and 18 (fly away) to help the world. UNIT 2 21 a-z Vocabulary 2 Phrasal Verbs 1 Circle the correct words. 1 I don’t want to stay in the graveyard by myself; please don’t leave me out / leave me behind! 2 Mary went to Mexico and brought back / brought about an interesting book about the Aztecs. 3 The White Lady of Castle Huntly is the ghost of a woman who passed down / passed away in the 17th century. 4 Look! Somebody has dug up / dug in one of the ancient graves! 5 Did you really think he’d cut the woman in half? I can’t believe you fell for / fell into that old trick. 6 I’ve been reading up on / reading out the Bermuda Triangle ... some bizarre things have happened there. 2 N ow match the phrasal verbs you didn’t use in 1 with the meanings below and then write a sentence using each one in your notebook. 1 : start doing something by chance 2 : give knowledge or teach skills to younger people 3 : say the words you are reading so people can hear them 4 : not include someone or something 5 : start eating hungrily 6 : make something happen Commonly Confused Words 3 Complete the pairs of sentences with the words in bold. 1 odd rare a That’s . This door has got a wall behind it. b The historian is interested in books. 2 last latest wish was to see her childhood home before she died. book – I can’t wait for his next one. a The woman’s b I’ve just finished Steven King’s 3 strength power ; they are people during the day and wolves at night. of many men until Delilah cut his hair. a Werewolves have a strange b Samson had had the 4 prizes prices on books about aliens and UFOs. for the people who look the scariest. a This bookshop has got great b At the Halloween party, there will be 5 shade shadow of that old tree. . a It’s very hot. Let’s go and sit in the b People say that vampires don’t have a 6 affects effects a We’re learning about the that the Europeans had on the Aztecs. b A siren is a kind of mermaid. They say their singing sailors in a strange way. Collocations & Expressions 4 Complete the sentences with these expressions with time. at times be just like old times have the time of your life no time like the present time and time again time waits for no man 1 There’s . Let’s clean out the attic right now. 2 Let’s have a Halloween party. It will when we were young. 3 I’ve told you to stay away from that old haunted house. 4 I feel like someone is watching me. It’s spooky! 5 I’m taking you on a ‘ghost tour’ of Edinburgh. You’ll ! 6 ... nobody can stop it or make it go more slowly. 22 Grammar 2 Used to, would, be/get used to 1 Read about the uses of used to, would, be/get used to. Used to Be/Get used to We use used to + bare infinitive for actions that • We use be used to + gerund/noun to talk we did regularly in the past, but that we don’t do about something that is usual or familiar. now and for states that existed in the past, but that We are used to hearing strange sounds in don’t exist now. the attic. The archaeologist used to travel to fascinating • We use get used to + gerund/noun to talk places when he was young. about the process of something becoming Molly used to enjoy reading mystery novels, but familiar. now she doesn’t. He is getting used to living near a cemetery. He quite likes it now. Would • Be and get change depending on the tense We use would + bare infinitive only for actions that that is needed in the context. we did regularly in the past, but that we don’t do now. Pam’s used to hearing her dog bark late at night. T he ghost would disappear as soon as anyone tried Kevin has never got used to staying in his to take a picture of it. grandparents’ old house. 2 Read these sentences and match them to their meaning. 1 She is getting used to living alone. a She doesn’t live alone any more. 2 She is used to living alone. b It’s no longer strange or difficult for her. 3 She used to live alone. c It’s beginning to feel normal, easier, etc. Read 2.3-2.5 of the Grammar Reference before you do the tasks. 3 C omplete the sentences with the correct form of used to and the verbs in brackets. In which of the sentences in 3 could you also use would? 1 They (go) to Stonehenge for the festival every summer. 2 As a child, I (dress up) on October 31st. 3 My uncle (write) crime stories when he was younger. 4 (you believe) in werewolves and vampires? 5 Tony and I 6 Sarah Winchester (not like) reading about aliens, but now we do. (sit) in the Blue Room every night. 5 Circle the correct answers. 4 The Smiths moved into an old castle. 1 A: How is your son? B : He’s fine. He used to / is getting used to university life. They didn’t like it at first, but they have got used to some things and are 2 A: D id Mr Bones use to / Is Mr Bones used to work in getting used to others. Write sentences that graveyard? about them in your notebook using the correct form of be/get used to. B: No, he worked in the one in my village. 1 live in the countryside (It’s starting to feel 3 A: Dina isn’t used to cooking / wouldn’t cook her own meals. normal.) B: That’s because her mum always cooks for her. 2 own such a big building (It’s still strange.) 4 A: Fran looks different now. B: Yes. She would / used to wear glasses. 3 hear bizarre sounds at night (It’s starting to feel normal.) 5 A: I’ve never used this computer program before. B: Don’t worry; you’ll get used to / be used to it. 4 s ee ghosts in the garden (It’s no longer strange.) 6 A: D o you remember staying with Grandma when we were kids? 5 get a lot of curious visitors (It’s no longer strange.) B: Y es, she got used to / would tell us spooky stories at bedtime. UNIT 2 23 Listening 1 You are going to hear someone talking about the legend of Robin Hood, a character who lived in England around the year 1300. Listen to the first part of the talk and circle the correct words. 1 According to the legend, Robin Hood lived in Sherwood Forest / Nottingham Forest. 2 Robin Hood lived in the forest with his family / friends. 3 An outlaw is a criminal who is wanted by / working with the authorities. 4 Robin Hood and the Sheriff of Nottingham were well known to be friends / enemies. 5 The legend says that Robin Hood used to steal from the rich / poor. 2 Look at questions 1-8 in 3 below and answer these questions. 1 Y ou’ve already heard the first part of the talk. Can you remember which words complete the first two sentences? If not, can you guess? 2 Sometimes you can work out what kind of answer will go in the gaps. What sort of answers will go in the gaps in questions 3 and 5? 3 Question 4 refers to something being ‘passed down’. What sort of things can people pass down? 4 What possible answers are there for question 6? 5 Have a guess at the answers for the other questions, and write your guesses in pencil at the end of each question. After you’ve done task 3, see how close your guesses were. 3 Now listen to the whole of the speech about the legend of Robin Hood. For questions 1-8, complete the sentences with a word or short phrase. 1 T he legend says that Robin Hood would steal money from wealthy passing through Sherwood Forest. 2 A lthough they were really criminals, Robin and his men were actually thought of as because they helped the poor. 3 The legend of Robin Hood has interested people for over . 4 Before modern communications, people used to pass down using songs and poems. 5 Kind Edward II was king of England from 1284 to . 6 South Yorkshire is an area which is a short distance to the of Nottingham. 7 King John ruled England before King Edward II. 8 Robin Hood is a popular character in films and on television because he helped the and was against the wealthy rulers of the period. It’s important to read the questions carefully before you listen to the recording, and to think about what sort of words the answers might be. That way you’ll know what to listen out for when you hear the recording. 24 Speaking 1 Ask and answer the questions with a partner. • What do you know about the history of your local area? • Do you find historical mysteries interesting, or do you prefer to know all the facts? • Have you or has anyone you know ever seen a ghost? If not, would you like to? 2 I n speaking tasks, you’re often asked to compare several ideas and then choose which you think are most suitable in the situation given. Therefore you need to be familiar with using the comparative and superlative forms. Choose the correct options from the sentences below. 1 That’s quite a good idea, but I think a best / better idea would be ... This type of task is asking you 2 I don’t feel that ... is more interesting / as interesting as ... . to discuss the advantages and 3 The most / more useful idea out of all the options is ... disadvantages of all the options 4 I would prefer ... because it is less / least expensive than ... . before you make your final choice, 5 ... is more likely to get results than / as ... . so don’t just decide which two 6 I think I would prefer / rather to do ..., because ... options you think are best and talk only about those. You must discuss 3 Work with a partner. Your teacher has asked you and your partner what you think about each option first, and then choose the best one. to research and write a project about a mystery in your area. Here are some ways in which you could investigate and discover information. First, talk to each other about how useful each idea would be. Then decide which two ideas you would choose. Use the words and phrases in the Language Bank to help you. get books out of the How can we find out visit the local local library about local mysteries? museum do research on the ask elderly people Internet for stories from their past speak to local police officers 4 Work in pairs to discuss these questions. • Do you enjoy reading books or watching television/films about mysteries? • D o you prefer mysteries about the supernatural (ghosts, vampires, etc) or crime mysteries? • W ould you like to experience living in the past, if you could? If so, which period? Why do you say that? Saying what you think Expressing a preference I think/don’t think that ... Personally I would prefer to/rather ... I feel/don’t feel that ... ... is more/less likely to ... I would say that ... ... would be more interesting/useful/helpful than ... I believe/don’t believe that ... ... is not as interesting/useful/helpful as ... UNIT 2 25 Writing Stories: Making it lifelike Stories contain description, action and people. You can make the reader care more about what happens to your characters by making them come to life and seem real. Two ways to do this are by writing what they say or think, and by describing how they feel. 1 Complete these sentences with a suitable verb and adverb to describe how the characters from different stories say something. Verbs Adverbs screamed shouted sighed angrily decisively excitedly told whispered happily nervously 1 She tiptoed into the old, dark house. ‘Hello? Is anyone here?’ she . 2 ‘Someone’s coming to save us!’ the boy . 3 ‘Leave me alone!’ she . . . 4 ‘I’m going to win this race!’ he himself 5 ‘This has been the best day of my life!’ she 2 N ow complete these sentences with a suitable adjective to describe how the characters from different stories feel. astonished desperate exhausted relieved terrified 1 Nick was . ‘I can’t believe it!’ he said. 2 Amy’s hands shook with fear as she picked up the phone. She was . 3 ‘Thank goodness I’ve found it at last,’ said Jan. ‘I’m so .’ 4 H e had been so determined to get to the top of the mountain, but now he was too to go any further. 5 She felt . ‘There must be something I can do to help,’ she thought. 3 Read this writing task and discuss the questions below it in class. You have seen this announcement in an English-language magazine. WYAdY oeneoutnuearerrr•s•mekstaatonliononrosroyeucoydkkrlmdiemptndourwguisofssotifenntombdirtenhasgocnetuiloundtrdoiwweoeshi:rtofhooflrtithvhoeieusdrhsteomhnueatrsegeen.a; czshein:eew. as Write your story. (140-190 words) 1 Can you think of one or two different kinds of stories you could write in answer to this writing task? 2 What feelings might the characters experience? 26 4 R ead the story that was written in answer to the question in 3 and answer the questions below it. Anne knocked on the door of the house; she was determined to find out who lived there. She had recently moved from America to the small village and had often admired the house’s beautiful rose garden. She knocked again nervously. There was still no answer, but a wonderful, sweet smell of cooking was coming from the kitchen. ‘Someone must be here,’ she thought hopefully. Just then she heard a soft cry; ‘Help me ..., please!’ She ran to the back of the house and pushed her way through the back door in panic. An old lady was lying on the kitchen floor. ‘I fell over and I think my ankle’s broken,’ she explained weakly. After calling for an ambulance, Anne comforted her. As she stroked the old lady’s soft white hair, she was astonished to see a birthmark on her neck. It was exactly the same shape as hers! Much later, they found out that the old lady was actually her great aunt Elizabeth. After that, Anne spent many happy evenings in the house listening to old family stories and eating delicious cake! 1 Does the writer explain the situation in the given sentence? 2 Does the writer include both points asked for in the task? 3 How many different feelings does Anne experience in the model story? Circle any words or phrases that show us how she feels. 5 Another way to bring your story to life is to use Time expressions Ways of speaking/thinking the next day argue some of the five senses (sight, hearing, smell, as/while complain/criticise/grumble taste, touch) in your description. Underline just then/suddenly scream/shout examples of these in the model story. after sigh after that/afterwards warn 6 N ow imagine you are on a beach in the summer. much later whisper wonder With a partner, discuss ideas for each of the Feelings five senses. astonished Senses brave(ly) see/notice/observe • hearing • sight • smell • taste • touch calm(ly) hear/can hear cheerful(ly) smell 7 R ead this writing task and use the plan and the confident(ly) taste confused touch/feel Language Bank to help you write your story. decisive(ly) salty/sweet/sour/bitter When you have finished your story, check your desperate(ly) the heat of the sun work carefully. excited(ly) the cool shade exhausted a soft breeze You have seen this announcement in a new English- frustrated raindrops language magazine for young people. miserable relieved CYAsY oaasownuuMryrt•sa•hostraauatokotrmswrwtyuyherrameismptsrseureaauisgasbwsteeotsabtuoisoentrrgactmyilopunfaitdoewhpercrei:oothowufrtaphnwaiespawesyermtnihntaeesgniodaclzedei:inbte.otsteler,iehse? scared Write your story. (140-190 words) Plan Make sure you include all points asked for in the task. Your story will be more lifelike and interesting if you: Paragraph 1: Setting the scene and • describe how your characters feel. explaining the given sentence • give them something to say or think. • use some of the five senses in your description. Paragraphs 2 & 3: Action and description UNIT 2 27 Paragraph 4: Ending 2 Reload Vocabulary Grammar Choose the correct answers. Choose the correct answers. 1 I think there might be life on other planets. Do you 1 ‘ two years ago?’ believe in ? ‘Yes, and we still don’t know what killed him.’ a historians a Did Ted die b aliens b Would Ted die c archaeologists c Was Ted dying d ghosts d Died Ted 2 When my old Uncle Nate died, I all his money. 2 Bert in ghosts, but he does now. a inherited a wasn’t used to believing b observed b got used to believing c confused c is getting used to believing d solved d didn’t use to believe 3 There was a woman in white walking down the 3 This old house is haunted. I hearing bizarre hallway and, suddenly, she ! noises in the attic. a investigated a used to b proved b get used to c discovered c am used to d disappeared d would 4 Where’s Pam? Oh, no! We’ve . We’ll have to go 4 Sir Arthur Conan Doyle, who passed away many back and get her. years ago, Sherlock Holmes. a left her behind a was creating b fallen for her b used to create c left her out c created d fallen out with her d would create 5 After his grandmother , he moved into her old 5 ‘ a haunted house in Connecticut?’ house. ‘No, I think she had one in California.’ a dug out a Did Ms Winchester use to own b passed down b Would Ms Winchester own c dug in c Did Ms Winchester get used to owning d passed away d Is Ms Winchester used to owning 6 That’s . I put my hat on this chair a minute ago, 6 The historian books about ancient graveyards but now it’s gone. and the myths surrounding them. a odd b haunted a was often reading c rare b read often d last c often read d often was reading 7 Tim has a for anything scary. He’s obsessed with 7 ‘Where were you at ten o’clock last night, sir?’ vampires and werewolves. ‘I upstairs, Officer.’ a power a was sleeping b passion b slept c strength c did sleep d pain d was always sleeping 8 I’ve told you – it’s not nice to play practical jokes 8 We were looking for evidence outside we saw a on your little sister. strange light in the garden. a at times b time and time again a as c to be just like the old times b when d time waits for no man c while d ago 9 Don’t be . There are no spirits living in this 9 ‘Do you know any ghost stories?’ house! ‘Lots! My older brother me one every night a spooky before I went to sleep.’ b bizarre a was telling c unusual b use to tell d ridiculous c would tell d tell 28 1 Progress Review Vocabulary 1 Circle the correct words. Helping at home creates happy families! Let’s face it: nobody enjoys 1 doing /making the chores, not even your mother! If you want to 2 get along with / get back at your family, everybody has to 3 do their fair share / lend a hand of the housework. If Mum 4 does / makes lunch, the kids can 5 do / make the washing up. If nobody 6 lifts a finger / puts their feet up, then people 7 grumble / accuse as the housework 8 piles on / piles up. 9 Do / Make time to do the housework together and you will all be 10 ashamed / proud of your home. 2 C omplete the second sentence so it has the same meaning as the first sentence, using the word in bold. You must use between two and five words, including the word given. 1 Dan is always asking his daughters to tidy their rooms. time Dan has asked his daughters to tidy their rooms . 2 Grandpa has retired and is really enjoying himself. life Grandpa has retired and is having . 3 Dad bought a dishwasher because he didn’t want to do any more washing-up. sick Dad bought a dishwasher because he doing the washing-up. 4 The two sisters argued about money. fell The two sisters over money. 5 This is my grandmother’s recipe for fruit cake. passed My grandmother this recipe for fruit cake to me. 6 Sam’s classmates took revenge for the practical joke he played on them. back Sam’s classmates for the practical joke he played on them. 3 Complete the sentences with these words. apology colleague contact evidence myth passion reality shadow 1 Nervous people are afraid of their own ! 2 Martha has made with her cousins in Australia and will be visiting them in the summer. 3 Young children often can’t tell the difference between fantasy and . 4 The Loch Ness Monster is just a(n) ! 5 The children bought their aunt flowers as a(n) for forgetting her birthday. 6 A(n) from the office lent Mum some spooky novels. 7 There is no that this old house is haunted. 8 My cousin loves programmes about aliens, so The X-files are his . 4 Circle the correct words. 1 When archaeologists / historians dug up the car park, they found some ancient bones. 2 Mediums say that they can communicate with aliens / spirits. 3 Police investigated / observed the mystery of the strange smell coming from the attic. 4 The detective has a theory / corridor that the victim’s wife is guilty. 5 Vampires supposedly lose their shade / power in daylight. 6 Today we will bring about / read out the titles of the best ghost stories this year. 7 This is a very old and rare / latest copy of Frankenstein. 8 Have scientists proved / solved that aliens exist? Progress Review 1 29 1 Progress Review Grammar 1 Complete the text with the verbs in brackets. Use the present simple, the present continuous, the past simple and the past continuous. Agatha Christie’s Poirot is coming back! Agatha Christie’s detective stories are world famous. During her life, she 1 (write) over 80 novels. In her first novel, The Mysterious Affair at Styles, she 2 (introduce) the most famous character that she 3 (create): the detective, Hercule Poirot. Poirot 4 (become) very popular with readers and 5 (appear) in over 30 novels. Agatha Christie 6 (pass away) in 1976, and now her grandson 7 (feel) that it is time for a new novel. Crime writer Sophie Hannah 8 (write) another book for Agatha Christie fans, in which the famous detective 9 (appear) once again. Sophie 10 (think) her novel will help younger readers discover the books of Agatha Christie, which she 11 (read) when she 12 (decide) to become a crime writer at the age of thirteen. 2 Complete the sentences with these words. for which that when where which whose why 1 This scary film is only for children are over 15 years old. 2 This is a photo of the day our family got a puppy. 3 For their anniversary, the couple visited the place they first met. 4 Agatha Christie, books are world famous, was born in 1890. 5 The reason this place is spooky is that it is very quiet. 6 Frankenstein is the novel the writer Mary Shelley is most famous. 7 The strange noises in the night, came from the attic, were very spooky. 3 C omplete the second sentence so it has the same meaning as the first sentence, using the word in bold. You must use between two and five words, including the word given. 1 As a boy, Ben was scared of the dark. used As a boy, Ben scared of the dark. 2 We never stayed at Grandma’s house when we were younger. use When we were younger, we at Grandma’s house. 3 Michelle has ten children, so a lot of noise doesn’t bother her. used Michelle has ten children, so she a lot of noise. 4 Our dog always barked when a visitor came to the door. would Our dog when a visitor came to the door. 5 Their puppy isn’t used to living with them yet. getting Their puppy living with them. 6 Did Grandpa live in this village when he was little? use in this village when he was little? 4 C omplete the sentences with the verbs in brackets. Use the past simple, the past continuous, used to or would. Sometimes there is more than one answer. 1 the police (find) anything while they (search) the garage? 2 The teenagers (watch) a scary film when something odd (happen). 3 W hen she (look) in the mirror, Lisa (see) something terrible and (scream). 4 While the police (investigate), more and more evidence (disappear). (win) every game. 5 In the holidays, the family (play) Monopoly and Dad 6 W hen she was young, Sue (not like) going to bed because she (believe) that there (be) monsters under her bed. 30 3 The World of Sport 1 Match the athletes to these sports. tennis football golf pole vaulting 1 2 3 4 Tiger Woods Cristiano Ronaldo Yelena Isinbayeva Novak Djokovic 2 Which of the athletes in 1 do you think makes the most money? DVD 3 Watch this short video about Tiger Woods. Which famous athlete does Gary Woodland compare Woods to? 31 Reading 1 W hich of the jobs below do you think are the most important? Rank them 1-7 where 1 is the most important and 7 is the least important. • actor • singer • athlete • social worker • doctor • teacher • politician 2 Q uickly read the article to find the different ways in which athletes earn money. Show me mothneey A B In 2009, it seemed that the world of football had That’s a lot of money, but there are even wealthier gone mad. Players were being transferred for sports stars than Ronaldo. The top-earning athlete astronomical amounts of money. Cristiano Ronaldo for 2012-2013 was golfer Tiger Woods. It is estimated was sold by Manchester United to Real Madrid that Woods earned $78.1m (€59m) from prize money, for well over €90 million. Zlatan Ibrahimovic went sponsorships, appearance fees and a successful golf from Internazionale to Barcelona for approximately video game. Golfers and tennis players such as Novak €70m, and Kaka left Italian AC Milan to play at Real Djokovic, earn prize money when they win tournaments, Madrid for over €65m. In football, transfer fees are and first prize is usually huge. Tiger Woods’ prize money paid to the clubs, and players are products that for 2012-2013 came to $13.1m (€10m). Unlike Ronaldo, can be bought and sold. The players make money Woods earned even more when he wasn’t playing. through salaries and sponsorship deals. Ronaldo, for Nike, one of Woods’ many sponsors, currently pay him example, earned around €17m in salary and €16m in more than $20m annually to promote their brand. That’s advertising and sponsorship deals for companies like a huge amount of money, but only a drop in the ocean Nike in the 2012-2013 season. for Nike, which makes $25 billion in sales a year. 32 3 Read the article again to find the following information. Which paragraph 1 For the multiple-matching task, you mentions how much money a famous company makes? 2 can get a better understanding of explains how football players earn their money? 3 the paragraphs if you quickly read describes jobs people do that help the world? 4 and summarise each one before suggests that sports just give us some fun? you begin answering the questions. mentions an athlete whose salary is higher than 5 Once you do this, you will be able 6 to go straight to the answers you his sponsorship deals? 7 need for the questions. For example, says that top athletes deserve their high incomes? 8 paragraph A talks about money talks about money athletes earn only when they win? in football. Which question can it states that professionals should earn similar incomes? directly answer? 4 Match these types of payments to the meanings 1-5. appearance fee prize money salary sponsorship deal transfer fee 1 : money that is paid to the runners up and winners of sports events 2 3 : money that is paid by one team to another team for a professional player 4 : p ayment for wearing a company’s clothing and using their equipment, or wearing 5 their logo on clothing : money that is paid to an athlete to take part in an event and make it more popular : payment for playing regularly in a team such as a football or basketball team 5 W ork with a partner. Student A is a world famous athlete who earns millions every year. Student B is a secondary school teacher on a more normal salary. Student A must justify earning far more than the teacher, and Student B needs to convince the athlete that teaching is more important than sport. Use the arguments below and some of your own ideas. Athlete Teacher • I make people happy when I score goals. • I help young people to learn important things. • I play for my country and make people proud. • I teach them how to be better people. • I can only work for a maximum of 10 years. • I prepare them for the future. CD There is no doubt that Ronaldo and Woods are talented Basically, athletes, like actors and singers, athletes, but is an athlete worth more than a doctor, provide entertainment. Based on how much teacher or social worker, for example? Some people money these people make, it seems that we argue that the top players should earn high salaries value entertainers more than professionals because they train hard to become the best in their that actually help people. And although sport. On the other hand, various other professions an athlete’s job is physically demanding, help to make our world a better place. Teachers athletes do not play as important a role in educate young people and their work produces the our societies as their salaries indicate. We citizens of tomorrow. Social workers help people who need to reconsider what is truly important are facing difficult challenges in life. The President of and get rid of the huge differences in income the USA makes decisions that affect not only his own earned by different professionals. If we country, but the whole world. These people earn far can do that, we can create societies where less than the average professional athlete, despite their everyone feels valued and appreciated for important contributions. what they do. UNIT 3 33 a-z Vocabulary 1 1 Label the pictures. Some of the letters are given to help you. 1 2 3 s _ _ _ sh b _ _ min _ _ _ cr _ _ k _ t 4 d _ _ ts 5 6 wr _ _ _ li _ g r_g__ 2 Complete the compound nouns with these words. arena course court park pitch ring rink track 1 ice-hockey/ice-skating 5 football/rubgy/cricket 2 golf 6 tennis/squash/badminton 3 skateboarding 7 race/athletics 4 boxing/wrestling 8 horse-riding/sports 3 Complete the sentences with some of the compound nouns from 2. 1 A(n) has got lines painted on it and a net in the middle of it. 2 T he local is a noisy fun place where teenagers like to hang out and practise their latest tricks. 3 Once you get to the , put on your skates, grab your stick and go out onto the ice. 4 There are ropes around the , so the athletes don’t fall out when they get hit. 5 This is a difficult ; there are lots of places where you can lose your ball while trying to get it into the holes. 6 After three days of rain, the grass on the was very wet and the players slipped a lot. 7 The was full of excited fans who were waiting for the race to start. 8 Luckily, the driver wasn’t hurt when his car went off the . 4 Match the verbs to their meanings. 1 breathe a to straighten your body, arms or legs to full length 2 stretch b to take air into your body and then let it out again 3 balance c to use your hands to make someone or something move towards you 4 inhale d to stay in one place without falling to one side or the other 5 push e to take air into your body 6 exhale f to make someone or something move away from you by pressing on them or it 7 pull g to move your body, or a part of it, so that it is not straight 8 bend h to let air out of your body 34 Grammar 1 Present perfect simple, present perfect continuous 1 Read about the uses of the present perfect simple and the present perfect continuous. Present perfect simple Present perfect continuous • something that started in the past and has • for actions that started in the past and are still continued until now in progress now or have happened time and time again until now He has coached wrestling for eight years. • something that happened in the past, but we We have been teaching basketball for years. He’s been having tennis lessons since he don’t know or we don’t say exactly when The team has bought new uniforms. was five. • something that happened in the past, but has • for continuous actions that happened in the a result or an effect in the present past and have finished recently, but have a Steven has broken his leg, so he isn’t playing result or an effect in the present in the match this week. S he’s tired because she’s been jogging. • to emphasise how long actions have been in • an action that has just finished or happened W e’ve just scored a goal! progress • experiences and achievements You’ve been practising for the badminton Our cricket club has won lots of prizes recently. game for weeks. P resent perfect simple vs present perfect continuous We use the present perfect simple to focus on the result of a completed action or how many times something has happened. However, we use the present perfect continuous to focus on the action itself or how long something has been happening. It is unimportant whether the action has finished or not. Carol has played squash once. Kevin’s been practising in the skateboarding park all weekend. 2 R ead the sentences. Which tense do they both use? In which sentence has the person not returned yet? a Mona has been to an ice hockey game in Canada. b Mona has gone to an ice hockey game in Canada. Read 3.1-3.3 of the Grammar Reference before you do the tasks. 3 C omplete the text. Use the present perfect simple or the present perfect continuous. The history of sport While people 1 (play) games and 2 (do) sport practically since the beginning of time, the rules which participants have had to follow 3 (change) over the centuries. Experts, historians and archaeologists, 4 (discover) that sport 5 (be) a useful way for people to learn how to deal with nature and the environment better. They 6 (also see) that as societies 7 (develop), sport and games have too. Archaeologists 8 (study) cave paintings for years now and they 9 (find) many which show athletes doing sport. In France, the paintings show people participating in wrestling and running about 17,300 years ago, and in Libya, in the Cave of Swimmers, evidence 10 (show) people taking part in competitive swimming. Although experts 11 (not answer) all the questions about why people play games and do sport yet, they 12 (prove) that nobody can argue about their importance in human history. UNIT 3 35 a-z Vocabulary 2 Word Formation 1 A dd the suffixes -tion, -ment, -ance or -ship to the verbs below to form nouns and then use them to complete the sentences. 1 pay 5 estimate 2 promote 6 appreciate 3 contribute 7 appear 4 sponsor 8 indicate 9 We’re raising money to build a new fitness centre and your generous will be a great help. 10 If Grant joins the gym, he’ll have to make a of €50 every month. 11 P ains in your feet and legs could be a(n) that you aren’t wearing the right shoes when you train. 12 This government department was started to deal with the of health and fitness in teens. 13 Ian is a golfer. He’s looking for from a sportswear company to help with his expenses. 14 Did you know that Tiger Woods earns huge amounts of money for every he makes? 15 Thanks, Mr Jones. We got you this gift to show our for everything you’ve done. 16 In your , who’s going to win the big match on Sunday? Collocations & Expressions 2 Which words do these adjectives collate with? Complete the table. big devoted extreme individual indoor/outdoor keen key loyal professional promising team top 1 11 2 22 SPORTS PLAYER FAN 3 33 4 44 3 N ow complete these sentences with some of the collocations from 2. Sometimes more than one answer is possible. 1 He’s not very good at co-operating with others, so he prefers like darts. 2 J oe’s only been with us for two months, but he’s our most . He’ll be a great athlete one day. 3 A t the moment, Julia plays golf for fun, but she hopes to become a(n) in a few years. 4 Peter is a(n) of wrestling. He never misses a match. 5 like football, cricket and basketball are great for teens. They teach them how to work together and get along with the other players. Phrasal Verbs 4 Circle the correct words to complete the sentences. 1 C an you believe that the sponsorship fees he gets each year come down to / come to more than a million euros? 2 A fter the match, the players took off / took to their football kit, showered and changed into their tracksuits. 3 A good coach always stands for / stands up for his players no matter what happens on the pitch. 4 Manchester United wants you to join the team? You can’t pass out / pass up a chance like that! 5 The boxer was seriously hurt and, sadly, doctors think he might not pull off / pull through. 5 Now match the phrasal verbs you didn’t use in 4 with the meanings below and then write a sentence using each one in your notebook. 1 : start liking something 4 : manage to do something difficult 2 3 : faint 5 : be the most important part of solution or problem : represent 36 Grammar 2 Past simple, present perfect simple 1 Read about past simple vs present perfect simple. In general, we use the past simple to talk about a The important point to remember is that the present completed action that happened at a specific time in perfect simple always has a connection with now, the past. We use the present perfect simple to talk whereas the past simple only tells us about the past. about something that happened at an unspecified time in the past or that happened in the past, but We also use the present perfect simple to give new that is still relevant to the present. information, but when we continue talking about it, I went to Spain to see Barcelona play in 2011. we usually use the past simple. (specific time in the past) A: ‘I’ve seen Barcelona play.’ I’ve been to Spain to see Barcelona play. B: ‘When did you see them?’ (unspecified time in the past) A: ‘I saw them in 2011.’ 2 Complete the sentences with the past simple or the present perfect simple. 1 We use with time expressions such as ago, in 1990 and the other day. 2 W e use with time expressions such as just, already, recently and so far. Read 3.4 of the Grammar Reference before you do the tasks. 3 Circle the correct words. 1 I just put on / have just put on my football kit. 2 Maria has already scored / already scored five points! 3 Did they spend / Have they spent their holiday hiking in Greece last summer? 4 Theo has taken / took tennis lessons in 2005. 5 My friend has been / was at a rugby match two days ago. 6 I didn’t watch / haven’t watched an ice hockey game so far. 7 Last week Helen and Iris went / have gone to the new sports arena. 8 He can’t play squash because he still didn’t buy / hasn’t bought a racket. 9 Did you ever see / Have you ever seen a rugby game? 10 We have waited / waited at the golf course for two hours ... where were you? 4 Complete the dialogues. Use the past simple or the present perfect simple. 1 A: Last night I (go) to a boxing match! B: Oh. I (already be) to two boxing matches. 2 A: Do you know that Joe B: Really? I thought he (work) at the sports arena for fifteen years? (start) working there five years ago. 3 A: (you / ever meet) a famous athlete? B: Well, I (see) Laila Ali box. A: W ow! I (watch) her father, Muhammad Ali, fight once. Sadly, he doesn’t box anymore. 4 A: Tony (break) his leg! (ride) my bike (not have) B: Really? How (it happen)? A: He (fall) while he was skiing. 5 A: Y esterday I (leave) the flat and to the gym. Then I (realise) that I my trainers with me. B: Oh, no! That (happen) to me before. What (do)? A: I (call) Mum to bring them to me. 6 A: How long ago (you / begin) coaching baseball? B: T en years ago. I (recently take) a team to the national finals ... and we (win)! UNIT 3 37 Listening 1 Label the pictures with these words. barbed wire burning logs ditch mud net wall 123 456 2 Always use the time that you have before hearing the recording to read the questions and think about what they, and the answer options, mean. Read questions 1-4 in 3 and underline the most important words. Compare with your partner whether you underlined the same words. If there are any words that you don’t understand, discuss them with your partner and try to guess the meanings from the context. 3 In this task, you will hear a short radio report and some questions. Before the report, you will have time to read the questions. Listen to the radio sports report and choose the best answer from the answer choices (A, B, C or D). 1 What is a Spartan race? Don’t panic if you read or hear some words A a race like a marathon but across fields that you don’t understand. You can probably B a race for disabled people have a guess at what they mean from the C a race for ex-soldiers context, and even if you can’t, you still might D a race with obstacles be able to answer the question correctly by eliminating the other three options. 2 What happened to James Simpson in 2009? A He joined the army. B He was sent to Afghanistan for the first time. C He was injured in an explosion. D He started running. 3 Why is James leaving the army? A to continue his education B to spend more time raising money for charity C to get a different job D to spend more time training for races 4 What does the speaker mean when she says “there could be no stopping him”? A James probably wants to stop running races now. B It will be difficult to beat James in future races. C James is likely to try even harder races from now on. D James’s future career won’t allow him to continue racing. 38 Speaking 1 Ask and answer the questions with a partner. • Would you like to take part in an extreme race like a Spartan race? • Do you prefer team sports or individual sports? Why? • Are you a fan of a particular team or athlete? Why do you support them? 2 W hen you are asked to talk about two photos, you need to compare them (say what is similar or different about them) as well as describe what you can see in each photo. Look at the phrases below and say whether you could use them to compare two photos When you talk about two photos, it’s a good idea or describe one photo at a time. Compare Describe to look at both pictures together first, and say what 1 Both photos show ... the common theme between them is. Then focus on each 2 The common theme of these photos is ... photo individually, say what it shows and how it differs 3 In the first photo I can see ... whereas in the second, ... from the other photo. Finally, remember to answer the 4 These photos are both of ... question about the photos. 5 There is ... in this photo, ... 6 I think this picture is of ... 7 The photos are similar/different because ... 8 On the other hand, photo B shows ... 3 Work in pairs to answer the questions about the photographs. One of you will be Student A and the other will be Student B. Use the words and phrases in the Language Bank to help you. AB Student A: Compare the two photographs. What are the advantages of each sport? Student B: Do you prefer indoor or outdoor sports? CD Student B: Compare the two photographs. Why do you think each sport is popular? Student A: Do you think it’s more important to win or to have fun when you do sport? 4 Work in pairs to discuss these questions. Comparing photos The similarities/differences between the photos are ... • Which sports do you think should be taught in Both photos show ... schools? The common theme of the photos is ... The photos have ... in common. • A re some sports more suitable for boys than girls, The photos are similar/different because ... and vice versa? In both photos I can see ... • I s participating in sport the best way to stay healthy? UNIT 3 39 What other ways can we look after our health? • D o you think most young people take enough exercise? Writing Essay: Thinking before you write An essay task will sometimes give you a question asking for your opinion and two ideas to help you write about it. Before you start writing, you must decide the following: • what your opinion is on the topic. • how you will use the two given ideas to support your opinion. • what the third idea will be. If you find this difficult, imagine chatting to a friend about the topic and the given ideas. What might you say? Write quick notes and then choose the best ideas to use in your essay. 1 Read this writing task and the two conversations that discuss notes 1 and 2 from the task. Which conversation do you agree with? You have had a class discussion on sport and a A: Top footballers? There are only a few money. Your teacher has now asked you to write an people in the world with such talent and essay for homework. skill. Excellence should be rewarded. Write your essay using all the notes and giving B: Yes, and it’s a hard life. They get up early reasons for your point of view. (140-190 words) and train for hours even in bad weather, as well as travelling and playing in the Many footballers get paid a lot of money. evenings and at weekends. Do they deserve it or not? Notes b A: There are plenty of talented and highly- Write about: skilled people in the world but they don’t earn millions. It’s not fair and it’s not 1 talent & skill necessary. 2 training & playing B: Right! And even though footballers train 3 (your own idea) and play hard during the season, they get more time off than most people do. 2 R ead these extra ideas which could be added to the conversations above. Decide which conversation they support and write a or b in the boxes. 1 Their careers are so short that they have to earn lots of money quickly. 2 It’s wrong to be paid so much for playing sport when, for example, there are so many badly-paid farmers, who provide something much more important. 3 Famous players don’t need such huge pay cheques from their clubs. They can also earn a lot in other ways, for example, by working with sportswear manufacturers. 4 They are important role models, inspiring youngsters and giving pleasure to millions of fans. 3 Read this writing task and discuss in class the two ideas in the notes. Can you think of a third idea to write about? You have had a discussion in class on sport and the media. Your teacher has now asked you to write an essay for homework. Write your essay using all the notes and giving reasons for your point of view. (140-190 words) The media publishes many details of sports personalities’ private lives. Do readers have a right to know these things or not? Notes Write about: 1 the right to privacy 2 their family & friends 3 (your own idea) 40 4 Read the essay written in answer to the question in 3 and answer the questions below it. The media is often full of stories about footballers and other sports stars. Readers are told how much money they earn and even details of their love lives. I think this is wrong. Sports celebrities should be allowed to keep their personal lives private. In the first place, sports personalities have as much right to privacy as anyone else. If journalists followed ordinary people around, taking photographs of them and reporting embarrassing facts about their everyday lives, they would be stopped. Moreover, it is not fair that sports stars’ families and friends should have to put up with so much attention. It can damage friendships and destroy relationships. However, I also believe that sports celebrities have a responsibility to set a good example to their young fans. If they take drugs or break the law, for instance, then readers should be told. All in all, sports stars have enough pressure on them when they are playing and competing in public. They shouldn’t have to put up with it in their private lives as well. 1 Does the writer clearly state his or her opinion in the first paragraph? 2 In which paragraphs are the two ideas from the Notes in the writing task discussed? 3 Does the writer’s third idea support or contrast with the main opinion expressed? 5 W hen you have an opinion about a subject, there may sometimes be a special point you want to include that contrasts with your main viewpoint, as in the model essay. You can use your idea either in support of your main opinion or in contrast to it. Read the following opinions and add a contrasting idea. 1 I think the Olympic Games are a good idea. They encourage sportsmen and women to work towards achieving their very best and they also help countries to come together in a peaceful way. However, . 2 I think doing a lot of sport is a waste of time. You don’t have enough energy or time to spend on other important things, and you lose touch with your friends. However, . 6 Read this writing task and use the plan and the Language Bank Before you start writing, take enough time to think about your to help you write your essay. When you have finished your essay, opinion and how you will support it check your work carefully. using the given ideas. Make notes about your own idea and plan You have been talking in class about training facilities for sport in your how you will use it in support of or country. Now your English teacher has asked you to write an essay for in contrast to your main opinion. homework. When you start writing, make sure Write your essay using all the notes and giving reasons for your point you express your ideas in formal of view. (140-190 words) language. Some countries spend a lot of money on providing world-class sports facilities for training talented youngsters. Is this a good way or a bad way to spend government money? Notes Introducing supporting ideas Write about: Firstly,/Secondly,/Finally, In the first place, 1 health & lifestyle Moreover, Furthermore, 2 international competition In addition, 3 (your own idea) Introducing a contrasting idea However, Plan On the other hand, Paragraph 1: Introduce the topic and your opinion. Paragraph 2: Use Note 1 to support your opinion. Conclusion Paragraph 3: Use Note 2 to support your opinion. All in all, Paragraph 4: Use your own idea in support or in contrast. To sum up, Paragraph 5: Re-state your opinion using different words and add On the whole, In conclusion, a comment. UNIT 3 41 3 Reload Vocabulary Grammar Choose the correct answers. Choose the correct answers. 1 If they want you to play professional cricket, you 1 ‘ our new basketball kit?’ shouldn’t the chance. ‘Yes! Aren’t the colours great?’ a take off a Were you seeing b pass out b Have you been seeing c take to c Have you seen d pass up d Did you seen 2 If you win the at the golf tournament, you’ll be 2 He’s earned more than a million euros in very wealthy. appearance fees this year! a appearance fee b salary a yet c transfer fee b ever d prize money c already d still 3 I don’t like watching because it looks like the two 3 ‘I two goals in the match at the weekend.’ people are fighting. ‘Wow! That’s amazing.’ a wrestling a scored b cricket b have scored c darts c have been scoring d badminton d just scored 4 Breathe in. Hold it. Good. OK, now slowly . 4 Where are the players? The fans for hours. a balance a have been waiting b pull b have waited c exhale c waited d stretch d wait 5 A requires a lot of water to keep it looking 5 Zoe practising at four o’clock, so we went out green. to eat. a skateboarding park a has finished b golf course b finished c ice-hockey rink c finish d boxing ring d has been finishing 6 I heard that Beckham might make a surprise at 6 ‘We about taking badminton lessons for ages.’ the football match on Sunday. ‘You should! It’s a great sport.’ a appearance a have been thinking b payment b have lately thought c indication c have thought d appreciation d thought 7 My friends and I like sports because, despite the 7 ‘ to the sports arena?’ danger, they’re very exciting! ‘Yes, but she’ll be back before it gets dark.’ a devoted a Did Jill went b extreme b Has Jill gone c promising c Has Jill been d keen d Has Jill been going 8 Can you believe the money that athletes earn can 8 I a lot of money playing darts recently, so I’ll take over a million euros a year? you to the cinema. a come down to a have already won b pull off b have winning c come to c have just won d pull through d have won 9 In your , who is the best athlete in the world? 9 ‘You look upset, Coach.’ a promotion ‘I am. Tony his arm yesterday, so he won’t be b sponsorship playing in Saturday’s match.’ c contribution a has been breaking d estimation b broke c has broken d breaks 42 4 Shopping Therapy 1 Look at the pictures. Where can you buy these items? 2 Imagine it’s your birthday. Make a list of the presents you would like to receive. Be realistic! Swap with a partner and see how your lists compare. DVD 4 Watch this short video about Harrods, the world’s most famous department store. What is Harrod’s motto? How many customers does Harrod’s have on average every day? 43 Reading A 1 Where do you prefer to buy these Play your favourite songs in minutes! items? Write S for traditional shops NO LESSONS NEEDED! or O for online shopping. The gTar by Incident is a fully 1 shoes digital guitar that lets you play 2 mobile phones music quickly and easily with 3 clothes the help of flashing, coloured 4 sports equipment lights and apps from your iPhone. 5 computer games 6 musical instruments Interactive fretboard 7 books • lights up in different ways to show you 8 electronics where to put your fingers 2 H ave you bought any of the items • tracks how well you’re doing as you play in 1 online? What are the The gTar app advantages and disadvantages • d esigned to help anybody start playing the of buying goods online? guitar as quickly as possible 3 Look at the picture of the gTar and • just pick a song and start playing • three levels of difficulty read the texts. Briefly describe how it works. B C NewRe-viTewe: cthehgTMar bay Igncaidezntine FAQs Itftfirhmuyasoettura.’a.vn.tedicnoegtmrviieetprdclepattionecklpbyele!ad.yuWapeslalo, gntughi,etaygroTufaorkr cnthohawenfghireosswt Where does the gTar get power from?  WsatacrsheiceesphdnitmeiicaItpa,pfllie,t.rhspCaoatglotssanuhuhutsdgteaieltthhdriaafcea,terrip.detItpcopPlolrwsaay,oembya;lpacioispkhlniltiueayongb’stno.lamoyytsmIhowegtaceua’enkslydranegotaeiiuhmTuPgwaiaorhnueartfo,esidytsenoI.a?eoaenrwTllOs,egihpdaycnailas!tsaccwrneytiioicdsivnIona’gdd’tte The gTar has a battery that lasts Priceindstaratum$mw3taehh9tneeo9tu,ewfrsiostasr’nseahtnnasotdnibtaoabalsnyfgfyioosroafrtnsdsg,epaubitlear between 6 to 8 hours when it is fully playing. charged. To charge the gTar, you can use the USB charger that is included or you can plug the gTar into any standard USB dock on a computer.  What phones will it work with? Currently the gTar is compatible with the iPhone 4/4S and the iPhone 5. We hope to make it possible to use with other smartphones in the future. How do I get the gTar app? The gTar app is available for free in the App Store. Will this teach me how to play on a ‘normal’ guitar? We designed the gTar to be virtually identical to a normal guitar, so playing it will teach you the basics that you would need to play on a regular guitar. 44 4 Use the information in the texts to answer the questions. Question 1 refers to section A For the four short connected texts, the last 1 What is true about the gTar? questions usually refer to something that a There are coloured lights on the app. the texts have in common. If the question b The songs can last a few minutes. tells you which texts to look at, like c You listen to the songs with your iPhone. question 6, underline the key words in the d The songs can become harder to play. question and then look for similar ideas in the named texts. If, however, it is like Question 2 refers to section B. question 7, you need to look at all of the 2 What is the writer’s opinion of the product? texts in order to figure out the answer. a He hadn’t expected it to be so good. b He found it rather frustrating. c It made him feel like an amateur. d It doesn’t match the maker’s claims. Questions 3 and 4 refer to section C. Questions 6 and 7 refer to sections A, B, C 3 Which statement about the gTar is NOT true? and D. a You pay nothing for the necessary app. b It can be used with any kind of smartphone. 6 W hich sections give information about how c You can play it for a few hours without recharging it. the gTar works? d It can help you to play a regular guitar. a A, B and C b A, B and D c A, C and D 4 What is the purpose of section C? d all sections a to sell more extras with the product 7 Who would probably want to buy a gTar? b to ask people’s opinions of the product a a member of a rock band c to promote the product to customers b someone already learning the guitar d to provide information many people need c a first-time guitar player Question 5 refers to section D. d a music teacher 5 What does Joe suggest in his email? a Jimmy should order the gTar from the website. 5 Complete the sentences with these words. b He will buy a present for Bob himself. c A group of them can share the cost. compatible genuine instructional d Bob has seen the gTar and wants it. regular sceptical standard 1 I need advice and information about how to use my new smartphone. I hope there is some D material I can From: Joe Fratiani view online. 2 My mobile phone isn’t very fancy; it’s just a phone that I can use to make calls and send texts. 3 You can’t use a Sony charger with a Nokia . phone as they aren’t 4 D igital cameras have become a feature that is available on most new mobile phones. 5 I was very when 3D TVs first came out because I thought it would be annoying to wear the special glasses. 6 The bag I wanted to buy was expensive because it was made of leather. https://www.facebook.com/incidentgtar/ 6 Think up a new gadget and write an advertisement for it. Include the following information: • what it does • who it would be suitable for • the cost • where it can be bought UNIT 4 45 a-z Vocabulary 1 1 Match the compound nouns with the meanings below. bargain hunter car-boot sale flea market full refund market stall price tag 1 sales receipt window shopping 2 : something attached to a product which says how much it costs 3 : m oney that you get back for a product because there is something wrong with it 4 5 or you have decided you don’t want it 6 : somebody who looks for the cheapest products : the activity of looking at things, but not buying them 7 : a place where old or second-hand things are sold : a document that you get from somebody which shows that you have given them 8 money for goods : a large table, or a small building that is open at the front, that is used for selling things : a place where people sell products, new and used, from the back of their vehicle 2 Complete the sentences by writing a vowel (a, e, i, o, u) on each line. 1 This iPhone uses the most _ dv _ nc _ d technology ... it can do almost anything. 2 This cool little gadget makes cooking fast and _ ff _ c _ _ nt. Get yours today! 3 The best thing about a laptop is that it’s p _ rt _ bl _. You can take it with you wherever you go. 4 This app lets you play the guitar like you’re a professional. What a n _ v _ l idea! 5 My new tablet is c _ mp _ ct and fits easily into my backpack. 6 Many teachers believe that e-readers are both practical and _ d _ c _ t _ _ n _ l. 3 Read the sentences. Write T (true) or F (false). Correct the sentences which are false. Write them in your notebook. 1 An outfit is a set of clothes that are worn together. 2 Accessories include things like scarves, belts and jewellery. 3 Shoes, boots and trainers are footwear. 4 Plastic, metal and glass are fabrics. 5 Sony, Nokia and Blackberry are all famous brands. 6 The design of a gadget doesn’t affect how well it works. 7 If a shirt has a pattern on it, it is one colour. 8 Before you wash new clothes, you should look at the label. 46 Grammar 1 Past perfect simple, past perfect continuous 1 Read about the uses of the past perfect simple and the past perfect continuous. Past perfect simple He had been working on his new gadget when • an action or situation that finished before a he cut his hand. particular time in the past • an action that happened before another action Dina had finished the shopping by two o’clock. in the past when we want to emphasise how • an action that happened before another action long it happened for in the past They had been taking guitar lessons for The shop had closed by the time Jimmy got there. months before they finally decided to order a gTar. Past perfect continuous • an action that finished before a particular time • an action that started in the past and was still in in the past and had a result that we could see progress when another action started or when Molly had been working hard all week and she something happened looked very tired. 2 Read the sentences. Which perfect tenses do they use? Which sentence could be changed into a question using How long? a Irene could send text messages because she had bought a new phone the day before. b Irene had been texting her friend all morning before she finally got a reply. Read 4.1-4.2 of the Grammar Reference before you do the tasks. 3 Use the verb in bold to complete each pair of sentences. Use the past perfect simple and the past perfect continuous. 1 look for his sales receipt for an hour before he found it in the kitchen. a Brad for his sales receipt in his wallet and in all the shopping bags b B rad before he found it in the kitchen. 2 buy rare books for ages, so she had a lot of them. a Julia more than fifty rare books. b By the time Julia was twenty, she 3 design so many efficient gadgets by the time he retired that his a Kent efficient gadgets for a long time, so he was very good at it. company gave him an award. b Kent 4 shop there before. a Tina knew the flea market had good prices because she at the flea market all morning. b Tina had no money left because she 4 Complete the sentences. Use the past perfect simple or the past perfect continuous. 1 A fter the shoppers (leave) the department store, the cleaners started to mop the floors. 2 The shop owner (not open) his shop that day because it was a holiday. 3 Melanie (search) for a special party dress for months before she found the perfect one online. 4 (they / invent) the Blackberry by the year 2000? 5 M y aunt (read) traditional books for ages when she decided to buy an e-reader in 2010. 6 We (just buy) a tablet when a newer design became available in shops. 7 (you / use) the smartphone for long when the screen went blank? 8 M y mum (learn) how to sew while she was in school, so she was able to make all her own outfits. UNIT 4 47 a-z Vocabulary 2 Phrasal Verbs 1 Circle the correct words to complete the sentences. 1 Good morning. Is it OK if I look round / look out for your shop? 2 Dad, can I have some money to get a new shirt? I’ll pay you off / pay you back next week. 3 The chemist’s on the corner never has any customers. I think it’s going to shut out / shut down. 4 I’ve done the laundry, so all you have to do is put the clean clothes away / put the clean clothes up. 5 I love the pattern on this dress – I think I’ll try it on / try it out. 6 A ‘fashion victim’ is someone who feels they must keep down / keep up with the latest styles. 7 She was put off / put on by the price of the computer; she didn’t buy it. 8 This beautiful red coat will really make you stand in for / stand out in a crowd! 2 Now match the phrasal verbs you didn’t use in 1 with the meanings below and then write a sentence using each one in your notebook. 1 : hang curtains, pictures, etc 2 : prevent something from increasing 3 : look carefully at people or things around you in order to find one particular person or thing 4 : place clothing or footwear on your body 5 : take the place of somebody else 6 : give money to somebody who will no longer work for you 7 : test something to see if you like it 8 : stop yourself from hearing, seeing or thinking about something Prepositions 3 Complete the phrases with in or on. 1 the sales 3 debt 5 an advert 7 credit 6 cash 2 special offer 4 fashion 4 Now complete the sentences with the phrases from 3. 1 Mum saw this cool gadget that was in one of the magazines that she reads. 2 If you don’t stop spending so much money, you’ll be by the time you’re twenty! 3 I want to get a new mobile phone , but they don’t start until August. 4 Mary is very stylish. She only wears clothes and footwear that is . 5 I had lots of money with me, so I decided to pay . 6 Wow! All this sports equipment is ; this tennis racket is only ten euros! 7 Dad bought his keyboard because he didn’t have enough cash to pay for it. Commonly Confused Words 5 Complete the sentences with both words. 1 fits suits you perfectly and the style really you too. That jacket 2 uniform costume for the fancy-dress party; he’s hired a police . Tony has got a great 3 borrow lend you my video game for a few days if you let me your MP3 player. I’ll 4 brochures catalogues and mail-order at €200! Please tidy up the living room. You can put the travel that are on the coffee table in this box. 5 bargain purchase was a new handbag. She said it was a Her latest 48 Grammar 2 Past perfect tenses, past simple 1 Read about the past perfect tenses vs past simple. In some sentences which talk about the past, it is clear which action happened first. In this case, we can use the past simple for both actions. However, when the order of events is not clear, or when we want to emphasise which action happened first, we can use the past perfect simple or the past perfect continuous for the first action. Mona did/had done her shopping before she met her friend for lunch. We knew later that we had spent too much money at the car-boot sale. They had been waiting for ages before a shop assistant came to help them. Note: We must use the past simple for both actions when one past action happens quickly after another. When my dog heard the loud thunder, it hid under my bed. 2 C omplete three of these sentences using the past simple in one of the gaps, and the past perfect simple or the past perfect continuous in the other gap. In which sentence do we have to use the past simple in both gaps? Why? a H e (try on) the jacket before he (go) to the check out to pay for it. b K aren (realise) the next day that the footwear she (buy) was no longer in fashion. c R ight after I (break) my new mobile phone, I (start) to cry. (stand) outside the shop for ages when it finally d T hey (open). Read 4.3 of the Grammar Reference before you do the tasks. 3 Read the sentences and underline the action that happened first. 1 We had been shopping for hours before we found a tablet that we liked. 2 Elena realised later that she had left her sales receipt at the bookshop. 3 As soon as he saw the gTar in an advert, Jim ordered it online. 4 When we had made our purchases, we took the bags out to the car. 5 By the time Lily got home, Mum had put away all the clean clothes. 6 They had just bought an expensive Blackberry when they saw the same one on special offer. 7 The shoppers had been waiting for a long time when the owner finally opened the doors of his shop. 8 Dora went back home because she had forgotten her handbag. 9 After Jill went to the bank, she lent me fifty euros. 10 Petro pushed a button on the keyboard and the DVD started to play. 4 C omplete the sentences. Use the past simple where possible. If the past simple is not possible, use the past perfect simple or the past perfect continuous. 1 B efore they realised they were in debt, my parents (spend) too much money for years. 2 By the time his friends came to get him, Jules (put on) his costume. (show) 3 The teenagers tried out the gadget for themselves after Clark them how it worked. 4 Karen’s clothes fitted her better because she (lose) some weight. 5 My sister (wait) for weeks when the shoes finally went on special offer. 6 Three weeks ago, I (start) the sewing course. 7 Pam (clean) all morning before she went window-shopping. 8 B efore he saw the phone he wanted, Brett (look round) the electronics shop for hours. UNIT 4 49 Listening 1 L ook at the pictures below. How many words can you think of that either name or are connected to each item? CD music rock band g u i t a rs 123 Look at all the pictures before you hear the 2 Look at the eight sets of pictures in 3 below. First, recording and think of the names for all the items you see. If you don’t know the names take turns with your partner to describe what you can of some of the items, think about what they see in each set of pictures, and then discuss what the are used for or connected to. This will help connection between each set of pictures is. you to relate the conversation to the pictures and therefore make it easier to choose the 3 You will hear eight short conversations. After each correct answer. conversation, a question is asked about what was heard. The answer choices are shown as pictures. Choose the picture (A, B or C) which answers the question. 1 5 ABC ABC 2 6 ABC ABC 3 7 ABC ABC 4 8 £50 £60 £120 A B C ABC 50 Speaking 1 Ask and answer these questions with a partner. • Do you enjoy shopping for clothes? Why/Why not? • Do you prefer to buy locally-produced items or well-known brands? • Which members of your family are difficult, or easy, to buy presents for? 2 W hen you give your advice about a situation, you need to be able to explain the pros and cons (advantages and disadvantages) of each option before you make your choice. Look at the following expressions and write A if they are introducing an advantage or D if they are introducing a disadvantage. 1 Option A has the risk of ... 4 The benefit of option B would be ... 2 The problem with option B is that ... 5 Option A might not be the best idea because ... 3 However, on the plus side, option A ... 6 Option B avoids the danger of ... 3 F ollow the instructions and complete the task with your partner. One of you will be Student A and the other will be Student B. Use the words and phrases in the Language Bank to help you. When it is your turn to ask questions, your partner will only tell you the disadvantages of each option. It is up to you to think of and talk about the advantages of each, and then explain which option you think is the better choice and why. Student A: Look at the pictures and use the information on page 189 to answer Student B’s questions. Student B: Look at the pictures and ask Student A these questions to find out what the situation is. You should ask: • What is the problem? • What are some possible solutions? • What are the disadvantages of each solution? Using the information you have learnt, give Student A your advice on what you think the best solution is and why. Explain why you didn’t choose the other solution. 4 Now swap roles. Look at the Extra Practice on page 189 and follow the instructions. 5 Work in pairs to discuss these questions. • Do you think online shopping will cause lots of smaller shops to close down? • In your opinion, are boys more interested than girls in electronic gadgets? • Do you think it’s important to spend money on birthday presents, or are there better ways of celebrating with someone? Contrasting advantages and disadvantages Although ... has the risk of ..., the benefit would be ... In spite of / Despite the problem of ..., it might be better because ... Even though ... might cause ..., on the other hand it might ... ... would be risky/less risky. However, on the plus side ... ... avoids the danger of ..., but ... UNIT 4 51 Writing Article: Getting your readers’ attention Unlike essays, which are a more serious way of discussing ideas, articles can entertain as well as inform readers. Your tone of voice can be less formal and you can get your readers’ attention by ‘talking’ to them in a more direct way. Use words like ‘we’ and ‘us’ to make readers feel included in what you are writing about and try putting some of your ideas in the form of a question, for example, ‘How would you feel if ….?’. 1 R ead these two alternative opening paragraphs and tick the one you think would make most readers continue reading the article. a M ncfohearawnneytxgeaepcmehtohnppeoleillre,oagmssypoentbhneieldwestempohdoooadmnyeesul.sscThaehvrmeeeyropyonroyfetedyeaunorc,ned. b mtp Hehuocohcwnhneoom?fltooeWgnnyee,dyaboloulyntwoaiautrn?ebtuwtyoe a new mobile have the latest spending too 2 N ow read this opening paragraph and use the Language Bank on the next page to help you rewrite it in a more interesting way for a teenage magazine. Teenagers are often told they spend too much money on brand-name fashion. They often buy expensive trainers, for example, when cheaper ones are just as good. 3 Read the following writing task and underline the three points that must be included in the article. Then answer the questions below. You have seen this announcement in an international magazine for teenagers. Articles wanted on 21st century lifestyles What is the one place where modern teenagers go shopping the most? Sports shops? Clothes shops? Electronics shops? Tell us what kind of shop, what they want to buy and why it is important to them. The best article will be published in next month’s magazine. Write your article. (140-190 words) 1 Who will be reading the article? 2 Could you use ‘we’ and ‘us’ in the article to talk to this type of reader? 3 T he task asks you to describe why the shop is important to you / young people generally. 52 4 R ead the article that was written in answer to the question in 3 and answer the questions below it. THbeuoeywninmagyaeonuysrhhlooopucrapslinedlgoecyintoruothnsipeces2n1sdhslotopoc?keIinnttgsuearetymnsewtogbaedtgheetsoannedpglaacmeewseycoaunw’taknetetpo aOnoogWtthtgwueefhnaeaowchtaemledsmehyymanspetntbtoiyifosshpeososrpeorlouttoatloetnurvhtmSnagsereiaalidyns!oonssptfounmgkotpukhretiissmevnediewinnfcedinausorgthsygco.rnomuahfOmtrdotsh.ustlooptNehohiswhrnligeiooarnecdnrypwyioes.lpdpno,wpMmroiagawneiwrnsdcuangee,einnsednyscsic,yqecgooahcuonuonwohimficfmpoacechiuusmnPa.hpeissgnaTnanoeiedwcetrgenfist,evtttnaaoosh.neandnnoIearnfttencggrdTwtitireotoaoeVthoerflhnsusuetnwceedpshceohesa?sweatlandtawnIoihnhtndftod.unnedehrayneolikyrklodwaniasueotrknen,eernogstygpdrgshtogeastueppunoaoopehpnnmdffoogiwuosmanpnetspiieletnhieiewnhtsneohrligraotpecechnoaoftlioeerhkdosmmreiollofniapmnipfvfngtutaueesidetsmatssenetttrirhlsya.t That’s worth shopping around for, isn’t it? 1 Has the writer answered the three points asked for in the task? 2 Underline the opinion expressed in paragraph 3. 3 L ook at the comparison that helps to explain this opinion. What two things does the writer compare? & 5 M aking comparisons can be a powerful way of explaining what you mean. Read this opinion and then write two different explanations making comparisons A lot of teenagers nowadays aren’t interested in reading books for pleasure. Asking the reader 1 the old days – now How often do you ...? How much do you ...? Do you ...? 2 at school – free time Could you ...? Would you ...? Can you imagine ...? Have you / Do you ever ...? 6 Read this writing task and then use the plan and the Language Bank How would you feel if ...? to help you write your article. When you have finished your article, Including the reader check your work carefully. you / your ... we / our ... You have seen this announcement in an international magazine for teenagers. us Articles wanted on living in the 21st century. What form of relaxation do teenagers nowadays enjoy most? Meeting friends? Using a computer? Playing sport? Tell us what kind of relaxation it is, what it’s like and why they enjoy it! The best article will be published in next month’s magazine. Write your article. (140-190 words) Catch the attention of your readers by making them think Plan about the topic of the article Title in their own lives. Do this by Paragraph 1: Introduce the topic and answer the main question asking them questions and including them in what you in the task. write. Don’t forget to write a title Paragraph 2: Describe the form of relaxation. for your article! Paragraph 3: Give your opinion on why they enjoy it. Paragraph 4: Conclusion – comment on your opinion UNIT 4 53 4 Reload Vocabulary Grammar Choose the correct answers. Choose the correct answers. 1 That’s a great . You’re the scariest vampire I’ve 1 She clothes when she realised she had no ever seen! money with her. a uniform b bargain a tried on c costume b had tried on d purchase c had been trying on d tries on 2 Let’s go in here. I need a new belt and this shop 2 He my tablet for months before he decided to sells . buy his own. a accessories a had been borrowing b designs b had borrowed c fabrics c borrowed d footwear d borrows 3 When I got this lamp home I realised it was broken. I 3 ‘ the shopping by noon?’ want a ! ‘Yes, I think so.’ a sales receipt a Had Mum finished b bargain hunter b Mum did finish c flea market c Had Mum been finishing d full refund d Mum had finished 4 These boots don’t me. I need a bigger size. 4 The electronics shop by the time we got there. a suit a had been closing b lend b closed c borrow c was closing d fit d had closed 5 If you don’t know how much that gadget costs, look 5 Nia for hours on her e-reader and her eyes at the . were red. a price tag a read b car-boot sale b reads c market stall c had read d window shopping d had been reading 6 Laptops are great because they are . That means 6 As soon as Dad saw the price tag, he to laugh. you can take them anywhere. a started a advanced b had been starting b portable c had started c educational d start d efficient 7 ‘Why did you stop buying things on credit?’ 7 You’ve got circles and squares on your shirt. It’s an ‘Because we we had been spending too much interesting . money recently.’ a label a had known b outfit b knew c brand c had been knowing d pattern d know 8 If you’re going to the shops, a jacket. It’s cold 8 ‘How long on this before you came up with the outside. perfect design?’ a put away ‘Oh, for about ten years.’ b put on a had you been working c put up b you had worked d put off c you had been working d would you work 9 If these are only ten euros, I’ll pay . Here you are. a in fashion b in debt 9 ‘Did you get a full refund?’ before it c in cash ‘Yes, I’d only used the computer d in the sales stopped working!’ 54 a ever b once c never d already

Bumi Gemilang

Blog Pendidikan dan Informasi

Buku Teks Bahasa Inggeris (English) Tingkatan 5 KSSM

English Form 5 Textbook KSSM.  Buku Teks Digital Bahasa Inggeris Tingkatan 5 KSSM. Pdf. Download. Text Book

Selari dengan perkembangan pesat teknologi digital, Kementerian Pendidikan Malaysia akan menggunakan teknologi dan kandungan digital dalam dalam bidang pendidikan.

Pengenalan buku teks digital akan diperkenalkan di sekolah menengah terlebih dahulu, kemudian di sekolah rendah. Inovasi pendigitalan buku teks membolehkan pelajar mendapatkan pengetahuan melampaui bilik darjah serta mengurangkan penggunaan kertas bagi mencetak buku teks bercetak.

………………………………………………………………………………………

Buku Teks Digital Bahasa Inggeris (English) KSSM Tingkatan 5  :

  • Bahasa Inggeris (English) Tingkatan 5 – Content
  • Bahasa Inggeris (English) Tingkatan 5 – Unit 1
  • Bahasa Inggeris (English) Tingkatan 5 – Unit 2
  • Bahasa Inggeris (English) Tingkatan 5 – Unit 3 .
  • Bahasa Inggeris (English) Tingkatan 5 – Unit 4
  • Bahasa Inggeris (English) Tingkatan 5 – Unit 5
  • Bahasa Inggeris (English) Tingkatan 5 – Unit 6
  • Bahasa Inggeris (English) Tingkatan 5 – Unit 7 .
  • Bahasa Inggeris (English) Tingkatan 5 – Unit 8
  • Bahasa Inggeris (English) Tingkatan 5 – Unit 9
  • Bahasa Inggeris (English) Tingkatan 5 – Unit 10
  • Bahasa Inggeris (English) Tingkatan 5 – Unit 11 .
  • Bahasa Inggeris (English) Tingkatan 5 – Unit 12
  • Bahasa Inggeris (English) Tingkatan 5 – Grammar Reference
  • Bahasa Inggeris (English) Tingkatan 5 – Back Matter
  • Buku Teks Digital Bahasa Inggeris (English) KSSM Tingkatan 5 (Unit 1 – Unit 12)

Jawapan Buku Teks Digital Bahasa Inggeris (English) KSSM Tingkatan 5  :

  • Jawapan Buku Teks Bahasa Inggeris (English) Tingkatan 5 KSSM

……………………………………………………………………………………………….

  • Koleksi Buku Teks Digital KSSM Tingkatan 5 (Lima)
  • Koleksi Buku Teks Digital KSSM Tingkatan 4 (Empat)
  • KOLEKSI Soalan Peperiksaan Percubaan SPM + Skema Jawapan (Semua Subjek) (Terkini)

…………………………………………………………………………………………….

NOTA-NOTA Tingkatan 5 yang Penting dan Berguna :

Nota Ringkas, Padat Sejarah Tingkatan 5 SPM (Bab 1-10)

Nota Ringkas, Padat Sains Tingkatan 5 SPM (Bab 1-12)

Nota Ringkas, Padat Matematik Tingkatan 5 SPM (Bab 1-8)

Nota Ringkas dan Padat Matematik Tambahan Tingkatan 5 SPM (Bab 1 – Bab 8)

Nota Ringkas, Padat Kimia Tingkatan 5 (SPM) (Bab 1-5)

Nota Ringkas, Padat Biologi Tingkatan 5 (SPM) (Bab 1-13)

Nota Ringkas, Padat Fizik Tingkatan 5 (SPM) (Bab 1-7)

Karangan Pilihan Untuk Bahasa Melayu (BM) SPM (Tingkatan 4, 5)

Modul Lengkap Bahasa Melayu (BM) Tingkatan 4, 5, SPM + Jawapan

Nota-Nota Tatabahasa dan Kesalahan Tatabahasa Bahasa Melayu (K)

Bahasa Melayu : Novel-Novel Tingkatan 4, 5 (SPM)

Bahasa Melayu Tingkatan 4, 5 (SPM) : Pantun, Syair, Sajak, Cerpen, Drama, Prosa Tradisional (A)

Contoh Karangan Bahasa Inggeris SPM (BI) / SPM English Essays (Form 4, 5)

Modul Lengkap Bahasa Inggeris (English) Tingkatan 4, 5, SPM + Jawapan

English Grammar Notes, Exercises + Common Errors In English

Nota Ringkas, Padat Perniagaan Tingkatan 5 (SPM) (Bab 1-7)

Nota Ringkas, Padat Ekonomi Tingkatan 5 (SPM) (Bab 1, 2)

Nota Padat dan Ringkas Prinsip Perakaunan Tingkatan 5 (SPM) (Bab 1 – Bab 7)

Nota Lengkap Pendidikan Islam Tingkatan 5, Soalan Topikal + Skema

Pendidikan Moral Tingkatan 5 : Soalan, Nota, Latihan, Modul … (PB)

Nota Ringkas dan Padat Geografi Tingkatan 5 (Bab 1 – Bab 10)

Koleksi Nota Pendidikan Syariah Islamiah (Tingkatan 4 dan 5)

Koleksi Nota, Modul, Soalan Pendidikan Seni Visual (PSV) SPM, Tingkatan 4 dan 5 + Jawapan

Nota Ringkas dan Padat PJPK Pendidikan Jasmani dan Pendidikan Kesihatan Tingkatan 5

Nota Ringkas dan Padat Tasawwur Islam Tingkatan 5 (SPM) (Bab 1 – Bab 6)

Pendidikan Al-Quran dan Al-Sunnah Tingkatan 5 : Soalan, Nota, Latihan, Modul … (PB)

Nota, Modul Bahasa Cina Tingkatan 4, 5, SPM + Jawapan

Nota, Modul Bahasa Arab Tingkatan 4, 5, SPM + Jawapan

Contoh-Contoh Karangan (Insyak) Bahasa Arab PT3 / SPM

Sains Komputer Tingkatan 5 : Soalan, Nota, Latihan, Modul … (PB)

Koleksi Nota Ringkas dan Padat Reka Cipta SPM, Tingkatan 4 dan 5

  • Bahan Rujukan Penting: UPSR, PT3, SPM, STPM, MUET, Tahun 1, 2, 3, 4, 5, 6, dan Tingkatan 1, 2, 3, 4, 5, 6

………………………………………………………………………………………………..

Koleksi Nota Ringkas dan Padat, Soalan, Latihan, Modul Tingkatan 1, 2, 3, 4, 5 dan Tahun 1, 2, 3, 4, 5, 6 :

  • Koleksi Nota Ringkas dan Padat, Soalan, Latihan, Modul Tingkatan 1, 2, 3, 4, 5 dan Tahun 1, 2, 3, 4, 5, 6
  • Koleksi Karangan Bahasa Melayu, Bahasa Inggeris (English Essays), Bahasa Arab: UPSR, PT3, SPM, STPM, MUET, Tingkatan 1, 2, 3, 4, 5, 6, Tahun 1, 2, 3, 4, 5, 6

……………………………………………………………………………………

  • Koleksi Soalan dan Latihan Tingkatan 5 + Jawapan
  • Koleksi Soalan dan Latihan Tingkatan 4 + Jawapan

…………………………………………………………………………………..

……………………………………………………………………………………………

  • Rujukan SPM  (Tingkatan 4 dan 5) : Soalan Peperiksaan Percubaan, Nota, Jawapan, Latihan …
  • Sejarah Kertas 3 SPM (Semua Bab – Tingkatan 4 dan 5) : Contoh Soalan Peperiksaan, Skema Jawapan, Teknik / Cara Menjawab    

…………………………………………………………………………………………….

  • Join Telegram dan Follow Facebook Blog Bumi Gemilang

……………………………………………………………………………………

  • Bahan-Bahan Rujukan Tingkatan 5 : Koleksi Soalan Peperiksaan, Nota, Latihan, Jawapan …
  • Bahan-Bahan Rujukan Tingkatan 4 : Koleksi Soalan Peperiksaan, Nota, Latihan, Jawapan …

★ untuk terima Soalan Peperiksaan, Jawapan, Tips, Ramalan, Nota, Latihan, Informasi …  .

★  Like dan Follow  Facebook  Kami :

. https://www.facebook.com/BumiGemilang2 .

★  Join / Sertai  Telegram  Kami :

. https://telegram.me/bumigemilang

Untuk mendapatkan segala Maklumat Terkini atau Updates blog Bumi Gemilang :

(1)  Follow / Like Bumi Gemilang Facebook Page .

  • https://www.facebook.com/BumiGemilang2

(2)  Join / Sertai    2 Telegram Groups blog Bumi Gemilang .

  • Join / Sertai  2 Telegram Groups To Follow Blog Bumi Gemilang

………………………………………………………………………………….

Untuk Rujukan SPM, Tingkatan 4 dan 5  (Soalan Peperiksaan, Nota, Jawapan, Latihan…) :

Komsas Bahasa Melayu : Antologi Tingkatan 4 dan 5 (Cerpen, Sajak, Pantun, Syair, Drama, Prosa Tradisional … ) :

  • Antologi Bahasa Melayu Tingkatan 4 dan 5    

Novel-Novel Bahasa Melayu Tingkatan 4 dan 5 :

  • Novel-Novel Bahasa Melayu Tingkatan 4 dan 5   

English Forms 4 and 5 : Novel + Literature Component (Poem, Short Story, Drama … ) :

  • English Forms 4 and 5 : Novel + Literature Component

(3)  Follow Twitter blog Bumi Gemilang .

  • https://twitter.com/BumiGemilang

(4)  Follow Google+ blog Bumi Gemilang .

  • https://plus.google.com/+BumiGemilang2

Terima Kasih kerana membaca post ini.

.baca Post-Post mengikut SUBJEK dan KATEGORI

…………………………………………………………………………………

Please Share This Post :

Write a comment cancel reply.

IMAGES

  1. [2022] Practise Writing Excellent Essay for SPM 1119 English KSSM

    english essay kssm

  2. ILMU BAKTI

    english essay kssm

  3. 【Ilmu Bakti】Simple Guide To Essay Writing English CEFR Paper 2 Form 1 2

    english essay kssm

  4. kssm english form 2

    english essay kssm

  5. Essay Kssm Email Format Spm Latest Spm English Paper

    english essay kssm

  6. {ANEKA} SIMPLE GUIDE TO ESSAY WRITING 2023 ENGLISH PAPER 2 FORM 1,2,3

    english essay kssm

VIDEO

  1. [English] KSSM Form 5 Biology Chapter 1.1 Ground Tissues (Note + Question)

  2. SBP 2023 K2 PART 3 ESSAY

  3. 【中文解说】F4 第一次面对考试要怎么办?Physics Essay 必懂的回答技巧!TTC 2024 F4 Free Seminar

  4. 【 ENGLISH 】Facing your F4 exam? Essential Physics Essay Tips! TTC 2024 F4 Free Seminar

  5. KSSM Form 5 Chemistry C1: Redox Essay Question 又是被电到头昏脑胀的一天

  6. Teknik Menulis karangan Book Review (SPM Paper 2/Part 3) #KSSM(1119/2) #SoalanspotSPM

COMMENTS

  1. Superb 2021 Model Essays for SPM

    Part 2: Guided Writing (20 marks) Students are advised to spend about 20 - 25 minutes for Part 2. The number of words. should be between 125 and 150 words. The task is writing an essay or elaboration of. points for or against an idea, plan or arrangement based on a guided stimulus. Part 3: Extended Writing (20 marks)

  2. Contoh Karangan Bahasa Inggeris SPM/ English Essays (Form 4, 5) Form 4, 5

    Contoh Karangan Bahasa Inggeris SPM (English Essays/ Writing) MUET/ SPM. Tingkatan 4, 5, 6. Form 4, 5, 6. Sekolah Menengah. Secondary School. ... Writing Tips And Essay Format English SPM (KSSM) (Zeti). A Birthday Party. A Camping Experience. A Day I Wished Had Never Happened. A Difficult Life (Story) A Festival Celebrated In Malaysia.

  3. Understanding The New SPM (2021) English 1119 Paper Format

    1. Very Similar to PT3-2019. In line with Kurikulum Standard Sekolah Menengah (KSSM) being fully implemented by 2021, we see changes being made to the 2021 SPM paper. Teachers who have taught PT3 classes will find the new SPM format very familiar (see PT3 outline in image below). Last year, a revised PT3 format for English was made publicly ...

  4. SPM Guided Writing Essay (a.k.a General Essay): A Detailed Look

    In this article, we'll focus on Part 2 of the SPM paper which is the guided writing essay (now known as the general essay). For a complete overview of the SPM English Paper 2 format, click here. The SPM Guided Writing/ General Essay Format . Let's start by looking at the structure of the Part 2 essay: Wordcount: 125 to 150 words

  5. Writing Practice SPM KSSM Part 2 (Guided Writing: Essay)

    Some basic guidelines for writing practice on Part 2 based on KSSM syllabus with some practice. You may adapt and adopt.

  6. Tips on How to Tackle the SPM English Papers 1 & 2

    SPM Paper 2. This essay and writing paper is worth 60 marks. However, the weightage in the overall SPM English paper is still at 25%. The time allocated for this paper is 90 minutes and the paper has 3 parts. Part 1 - Students are required to write a short note or email in less than 80 words. (20 marks)

  7. SPM English Paper 2: What You Need To Know

    Firstly, let's kick it off with a quick overview of the SPM English Paper 2 format: The paper is divided into three parts. You will need to write three essays in total. The time allocated for this paper is 90 minutes. As each section is worth 20 marks, the total mark for this paper is 60. This paper contributes 25% to your overall SPM English ...

  8. reading my ACTUAL A+ ENGLISH SPM ESSAY & English SPM ESSAY tips

    In this video, I read the actual essay that I wrote for SPM, and explain how to score A+ for English SPM! I included the best English spm essay tips! Enjoy~T...

  9. SPM English Essay Extended Writing (a.k.a Continuous Writing)

    The SPM English essay writing paper consists of three parts: Part 1 (Short Communicative Message), Part 2 (Guided Writing), and Part 3 (Extended Writing Task). To summarise the format, each section is worth 20 marks, and you are given 1 hour and 30 minutes to complete the paper.

  10. 160 Model Essays for SPM English

    Books. 160 Model Essays for SPM English. Christine Tan, Yong Fui Yin. Pelangi ePublishing Sdn Bhd, Jun 29, 2015 - Language Arts & Disciplines - 408 pages. This book is designed to help students improve their writing skills. From the interpretation of the question to the planning and writing process, the reader is guided step by step in two main ...

  11. Guided Writing Text Type: Essay Word: 125

    This document provides guidance on how to answer Part 2: Guided Writing questions for the KSSM English SPM exam. It explains that students will be given a situation and three prompts to address in an 125-150 word essay. The document offers sample questions and answers to demonstrate how to incorporate all given prompts, use linking words, and support opinions. It also provides general tips on ...

  12. Writing Component

    Part 1: Short Communicative Message. You need to write an essay of about 80 words based on the stimulus given. The essay can be an email, a short letter, a brief note, or a brief description. Aim of the message: To invite. To make a choice. To persuade. To express an opinion. To accept or decline an invitation.

  13. WRITING TIPS FOR KSSM F5

    4. Plan your essay by brainstorming ideas and list down points relating to the topic. 5. Write your essay in a logical order and suitable paragraphs. 6. Use varying sentences in your writing. 7. Use linking words and sequence connectors to connect and join ideas. 8. Write the essay in not less than 200 words. 9. Check punctuation, spelling, and ...

  14. ENGLISH MODULES SPM KSSM 2021 With A Collection of Movie ...

    This document provides information on several English modules for the SPM examination. It lists the title, price, description and availability for four modules: 1) SPM English 2021 CEFR KSSM module for Paper 1 and Paper 2 for RM60, 2) Revealing the Secrets of SPM English module for Paper 2 and Paper 3 for RM80, 3) A Collection of Narratives module containing 20 narrative essays for RM10, and 4 ...

  15. Malaysia Students: 46 Good SPM English Model Essays / Free Essay

    Want to read some samples of good essays for IELTS writing? Or simply looking some ideas and inspiration for your SPM English writing homework? Below is the list of 46 free model essays for SPM English, O-level, IELTS, TOEFL & MUET Writing. Descriptive Essays. Friend; Friends; My Best Friend; Describe an afternoon at the bus station; A ...

  16. English Tingkatan 1

    1.4.1 Express feelings and give 2.2.1 Demonstrate understanding by: appropriately according to (i) long and short ideas or solve problems • Circle map. simple descriptions of personal (i) identifying main ideas in given context: vowels 5.2.4 Share personal responses to literary • Tree map.

  17. Bahasa Inggeris (English) Tingkatan 1 2 3: Karangan / Essays

    English Form 1, 2, 3 : Writing Step By Step Handbook. Essay on Healthy Lifestyle. Essay on Mother's Day In English For School Kids and Children Mother's. Essay on My Best Friend - 7 Selected Essays on My Best Friend. Experience of Being In A Busy City. Experience of Waiting For A Bus At A Bus Station. Fire (Report). Flash Flood

  18. KSSM Literature in English

    KSSM Literature In English - Sample Questions and Model Answers. Click on each title below to check out our most comprehensive guide to questions, performance level 6 model answers and exclusive answering techniques for the SPM LIterature in English Paper. Prose (Novel and Short Stories)

  19. Success Model Essays SPM 2022

    PelangiBooks • Word Bank & Idioms for Vocab Enrichment. WM:RM18.95 / EM:RM18.95. JC108222 • Tips & Techniques for each section. ISBN 978-967-2720-21-8 • Wide Scope of Model Essays. View flipping ebook version of Success Model Essays SPM 2022 published by PENERBITAN PELANGI SDN BHD on 2022-01-05.

  20. English Form 2

    Pandai Notes is an initiative to provide educational notes based on the Malaysian national school curriculum (KSSR & KSSM)

  21. Email form 4 Guided Writing worksheet

    12/06/2020. Country code: MY. Country: Malaysia. School subject: English as a Second Language (ESL) (1061958) Main content: Essay writing (2012684) From worksheet author: Guided Writing. Email. Form 4 KSSM.

  22. FORM 5 ENGLISH TEXTBOOK KSSM

    View flipping ebook version of FORM 5 ENGLISH TEXTBOOK KSSM published by g-64322099 on 2021-02-21. Interested in flipbooks about FORM 5 ENGLISH TEXTBOOK KSSM? ... An essay task will sometimes give you a question asking for your opinion and two ideas to help you write about it. Before you start writing, you must decide the following:

  23. Buku Teks Bahasa Inggeris (English) Tingkatan 5 KSSM

    。 English Form 5 Textbook KSSM. Buku Teks Digital Bahasa Inggeris Tingkatan 5 KSSM. Pdf. Download. Text Book Selari dengan perkembangan pesat teknologi digital, Kementerian Pendidikan Malaysia akan menggunakan teknologi dan kandungan digital dalam dalam bidang pendidikan. Pengenalan buku teks digital akan diperkenalkan di sekolah menengah terlebih dahulu, kemudian di sekolah rendah. Inovasi ...